Rv1863c Family assigned · medium auto-curated

H37Rv Rv1863c · MTBC0 - · 256 aa · 2110591–2111361 (-) · RefSeq NP_216379.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Integral membrane protein. Pfam: Rce1-like (PF02517.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P95152 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAbortive infection protein
Orthologous groupCOG1266
KEGG orthology K07052

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.155 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rce1-likePF02517.22 1.8e-15130–243 Type II CAAX prenyl endopeptidase Rce1-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1865c (short-chain type dehydrogenase), high confidence from genomic context alone (score 781 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1864c hyp hypothetical protein 782 782 ctx neighborhood:781
Rv1865c short-chain type dehydrogenase 781 781 ctx neighborhood:781
Rv1069c hyp hypothetical protein 687 688 ctx cooccurence:676
Rv0955 integral membrane protein 670 671 ctx cooccurence:663
Rv1159 pimE polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase 647 648 ctx cooccurence:637
Rv3604c transmembrane protein 642 642 ctx cooccurence:641
Rv1375 hyp hypothetical protein 656 636 coexpression:623
Rv2378c mbtG L-lysine N6-monooxygenase 616 616 ctx cooccurence:616
Rv0236c aftD alpha-(1->3)-arabinofuranosyltransferase 596 596 ctx cooccurence:585
Rv1866 hyp hypothetical protein 580 580 ctx neighborhood:514
Rv0204c transmembrane protein 566 567 ctx cooccurence:543
Rv1747 ABC transporter ATP-binding protein/permease 583 554 coexpression:434
Rv0585c integral membrane protein 535 535 ctx cooccurence:525
Rv1867 hyp hypothetical protein 487 487 ctx neighborhood:487
Rv1686c ABC transporter permease 502 484 coexpression:410

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
  • Pfam (hmmscan --cut_ga): Rce1-like PF02517.22 (E=2e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216379.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rce1-like (PF02517.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1266
  • Curated reference: UniProt P95152 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor Rv1865c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1863c|
MSDHLTACAAVHPGPLVSHLSVMHRFRIYVDIAVVVLVLVLTNLIAHFTTPWASIATVPAAAVGLVILVRSRGLGWAELGLSRQHWKSGLVYALAAVALVVAVISVGVLLPITRPMFMNHHYATISGAVIASMVMIPLQTVIPEELAFRGVLHGALNRAWGFRGVAVAGSVLFGLWHIATSLGLTSSNVGFTRLFGGGIIGLVAGVMLAVLATGVAGFVFSWLRRRSGSLIAPIALHWSLNGMGALAAALVWHLST