Rv0458 Family assigned · medium auto-curated

H37Rv Rv0458 · MTBC0 mtbc0_000482 · 507 aa · 553040–554563 (+) · RefSeq NP_214972.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)aldehyde dehydrogenase
MTBC0 PGAP re-annotationaldehyde dehydrogenase family protein
Revised (this work)Aldehyde dehydrogenase family protein. Pfam: Aldedh (PF00171.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNY1 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable aldehyde dehydrogenase
EC (curated) EC 1.2.1.3

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namealdA
eggNOG descriptionBelongs to the aldehyde dehydrogenase family
Orthologous groupCOG1012
KEGG orthology K00138, K18370
KEGG pathways map00010, map00620, map00640, map01100, map01110, map01120
Gene Ontology (30) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419 +18 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.645 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AldedhPF00171.28 7.8e-15328–494 Aldehyde dehydrogenase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0457c (peptidase), high confidence from genomic context alone (score 775 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0459 hyp hypothetical protein 994 995 ctx neighborhood:882 cooccurence:770 coexpression:827
Rv3667 acs acetyl-CoAsynthetase 951 947 coexpression:416 database:900
Rv0409 ackA acetate kinase 926 922 database:900
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 924 921 database:900
Rv0761c adhB alcohol dehydrogenase B 924 921 database:900
Rv1530 adh alcohol dehydrogenase 924 920 database:900
Rv1862 adhA alcohol dehydrogenase A 919 914 database:900
Rv3045 adhC NADP-dependent alcohol dehydrogenase 927 912 database:900
Rv3535c hsaG acetaldehyde dehydrogenase 913 904 database:900
Rv2922A acyP acylphosphatase 907 903 database:900
Rv0460 hyp hypothetical protein 783 784 ctx neighborhood:783
Rv0457c peptidase 783 775 ctx neighborhood:763
Rv1549 fadD11.1 Possible fatty-acid-CoA ligase FadD11.1 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase); Rv1549, (MTCY48.16c), len: 175 aa. Possible f 772 764 coexpression:742
Rv2485c lipQ carboxylesterase LipQ 748 740 coexpression:739
Rv0461 transmembrane protein 740 740 ctx neighborhood:739

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: aldehyde dehydrogenase
  • MTBC0 PGAP product: aldehyde dehydrogenase family protein
  • Pfam (hmmscan --cut_ga): Aldedh PF00171.28 (E=8e-153)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214972.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aldedh (PF00171.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1012
  • Curated reference: UniProt P9WNY1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 75 functional partner(s); context anchor Rv0457c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000482|Rv0458|
MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTGQPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEVWDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGAEAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHDDFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETMLGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRIFKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVNCYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF