Rv0458 Family assigned · medium auto-curated
H37Rv Rv0458 · MTBC0 mtbc0_000482 ·
507 aa · 553040–554563 (+) ·
RefSeq NP_214972.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | aldehyde dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | aldehyde dehydrogenase family protein |
| Revised (this work) | Aldehyde dehydrogenase family protein. Pfam: Aldedh (PF00171.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNY1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable aldehyde dehydrogenase |
| EC (curated) |
EC 1.2.1.3
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | aldA |
| eggNOG description | Belongs to the aldehyde dehydrogenase family |
| Orthologous group | COG1012 |
| KEGG orthology |
K00138, K18370
|
| KEGG pathways |
map00010, map00620, map00640, map01100, map01110, map01120
|
| Gene Ontology (30) |
GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419 +18 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.645 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 10 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Aldedh | PF00171.28 | 7.8e-153 | 28–494 | Aldehyde dehydrogenase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0457c (peptidase), high confidence from genomic context alone (score 775 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0459 hyp |
hypothetical protein | 994 | 995 ctx | neighborhood:882 cooccurence:770 coexpression:827 |
Rv3667 acs |
acetyl-CoAsynthetase | 951 | 947 | coexpression:416 database:900 |
Rv0409 ackA |
acetate kinase | 926 | 922 | database:900 |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 924 | 921 | database:900 |
Rv0761c adhB |
alcohol dehydrogenase B | 924 | 921 | database:900 |
Rv1530 adh |
alcohol dehydrogenase | 924 | 920 | database:900 |
Rv1862 adhA |
alcohol dehydrogenase A | 919 | 914 | database:900 |
Rv3045 adhC |
NADP-dependent alcohol dehydrogenase | 927 | 912 | database:900 |
Rv3535c hsaG |
acetaldehyde dehydrogenase | 913 | 904 | database:900 |
Rv2922A acyP |
acylphosphatase | 907 | 903 | database:900 |
Rv0460 hyp |
hypothetical protein | 783 | 784 ctx | neighborhood:783 |
Rv0457c |
peptidase | 783 | 775 ctx | neighborhood:763 |
Rv1549 fadD11.1 |
Possible fatty-acid-CoA ligase FadD11.1 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase); Rv1549, (MTCY48.16c), len: 175 aa. Possible f | 772 | 764 | coexpression:742 |
Rv2485c lipQ |
carboxylesterase LipQ | 748 | 740 | coexpression:739 |
Rv0461 |
transmembrane protein | 740 | 740 ctx | neighborhood:739 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: aldehyde dehydrogenase
- MTBC0 PGAP product: aldehyde dehydrogenase family protein
- Pfam (hmmscan --cut_ga): Aldedh PF00171.28 (E=8e-153)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214972.1)
- Domains: Pfam-A via hmmscan --cut_ga — Aldedh (PF00171.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1012 - Curated reference: UniProt P9WNY1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
75 functional partner(s); context anchor
Rv0457c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000482|Rv0458| MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTGQPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEVWDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGAEAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHDDFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETMLGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRIFKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVNCYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF