Rv1766 Family assigned · medium auto-curated

H37Rv Rv1766 · MTBC0 mtbc0_001880 · 89 aa · 2017730–2017999 (+) · RefSeq NP_216282.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmetal-sensitive transcriptional regulator
Revised (this work)Metal-sensitive transcriptional regulator. Pfam: Trns_repr_metal (PF02583.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06799 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecsoR
eggNOG descriptionMetal-sensitive transcriptional repressor
Orthologous groupCOG1937

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Trns_repr_metalPF02583.23 9.4e-2410–84 Metal-sensitive transcriptional repressor

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: csoR (copper-sensing transcriptional repressor CsoR), high confidence from genomic context alone (score 733 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0967 csoR copper-sensing transcriptional repressor CsoR 873 733 ctx cooccurence:733 textmining:545
Rv1767 hyp hypothetical protein 726 669 ctx neighborhood:659
Rv0774c hyp hypothetical protein 502 484 coexpression:409
Rv2259 mscR S-nitrosomycothiol reductase MscR 468 447 coexpression:429
Rv0761c adhB alcohol dehydrogenase B 468 447 coexpression:429
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 468 447 coexpression:429
Rv3086 adhD alcohol dehydrogenase D 468 447 coexpression:429
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 449 429 coexpression:411
Rv1639c hyp hypothetical protein 448 427 coexpression:409
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 448 427 coexpression:409
Rv1288 hyp hypothetical protein 453 426 coexpression:407
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 446 425 coexpression:407
Rv3803c fbpD MPT51/MPB51 antigen 446 425 coexpression:407
Rv3286c sigF RNA polymerase sigma factor SigF 406 406 experimental:406
Rv1768 PE_PGRS31 PE-PGRS family protein PE_PGRS31 684 368 textmining:520

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: metal-sensitive transcriptional regulator
  • Pfam (hmmscan --cut_ga): Trns_repr_metal PF02583.23 (E=9e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216282.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Trns_repr_metal (PF02583.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1937
  • Curated reference: UniProt O06799 (TrEMBL, unreviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor csoR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001880|Rv1766|
MIGDQDSIAAVLNRLRRAQGQLAGVISMIEQGRDCRDVVTQLAAVSRALDRAGFKIVAAGLKECVSGATASGAAPLSAAELEKLFLALA