Rv1766 Family assigned · medium auto-curated
H37Rv Rv1766 · MTBC0 mtbc0_001880 ·
89 aa · 2017730–2017999 (+) ·
RefSeq NP_216282.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | metal-sensitive transcriptional regulator |
| Revised (this work) | Metal-sensitive transcriptional regulator. Pfam: Trns_repr_metal (PF02583.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06799
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | csoR |
| eggNOG description | Metal-sensitive transcriptional repressor |
| Orthologous group | COG1937 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Trns_repr_metal | PF02583.23 | 9.4e-24 | 10–84 | Metal-sensitive transcriptional repressor |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: csoR (copper-sensing transcriptional repressor CsoR), high confidence from genomic context alone (score 733 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0967 csoR |
copper-sensing transcriptional repressor CsoR | 873 | 733 ctx | cooccurence:733 textmining:545 |
Rv1767 hyp |
hypothetical protein | 726 | 669 ctx | neighborhood:659 |
Rv0774c hyp |
hypothetical protein | 502 | 484 | coexpression:409 |
Rv2259 mscR |
S-nitrosomycothiol reductase MscR | 468 | 447 | coexpression:429 |
Rv0761c adhB |
alcohol dehydrogenase B | 468 | 447 | coexpression:429 |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 468 | 447 | coexpression:429 |
Rv3086 adhD |
alcohol dehydrogenase D | 468 | 447 | coexpression:429 |
Rv3804c fbpA |
diacylglycerol acyltransferase/mycolyltransferase Ag85A | 449 | 429 | coexpression:411 |
Rv1639c hyp |
hypothetical protein | 448 | 427 | coexpression:409 |
Rv0129c fbpC |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 448 | 427 | coexpression:409 |
Rv1288 hyp |
hypothetical protein | 453 | 426 | coexpression:407 |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 446 | 425 | coexpression:407 |
Rv3803c fbpD |
MPT51/MPB51 antigen | 446 | 425 | coexpression:407 |
Rv3286c sigF |
RNA polymerase sigma factor SigF | 406 | 406 | experimental:406 |
Rv1768 PE_PGRS31 |
PE-PGRS family protein PE_PGRS31 | 684 | 368 | textmining:520 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: metal-sensitive transcriptional regulator
- Pfam (hmmscan --cut_ga): Trns_repr_metal PF02583.23 (E=9e-24)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216282.2)
- Domains: Pfam-A via hmmscan --cut_ga — Trns_repr_metal (PF02583.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1937 - Curated reference: UniProt O06799 (TrEMBL, unreviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
csoR - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001880|Rv1766| MIGDQDSIAAVLNRLRRAQGQLAGVISMIEQGRDCRDVVTQLAAVSRALDRAGFKIVAAGLKECVSGATASGAAPLSAAELEKLFLALA