Rv1772 Family assigned · medium auto-curated

H37Rv Rv1772 · MTBC0 mtbc0_001886 · 103 aa · 2024647–2024958 (+) · RefSeq NP_216288.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationANTAR domain-containing protein
Revised (this work)ANTAR domain-containing protein. Pfam: ANTAR (PF03861.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06805 TrEMBL · unreviewed · Predicted
UniProt nameANTAR domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionANTAR
Orthologous group29RFB

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.235 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ANTARPF03861.20 6.3e-0925–70 ANTAR domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1771 (L-gulono-1,4-lactone dehydrogenase), medium confidence from genomic context alone (score 456 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1771 L-gulono-1,4-lactone dehydrogenase 456 456 ctx neighborhood:453
Rv1770 hyp hypothetical protein 456 455 ctx neighborhood:452
Rv1769 hyp hypothetical protein 453 453 ctx neighborhood:451
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 554 65 textmining:543
Rv2846c efpA MFS-type transporter EfpA 807 64 textmining:803
Rv2245 kasA 3-oxoacyl-ACP synthase 1 547 55 textmining:541
Rv1908c katG catalase-peroxidase 446 55 textmining:438
Rv2247 accD6 acetyl-/propionyl-CoA carboxylase subunit beta 445 55 textmining:437
Rv0341 iniB isoniazid inducible protein IniB 654 54 textmining:650
Rv0343 iniC iIsoniazid inductible protein IniC 481 52 textmining:475
Rv1909c furA ferric uptake regulation protein FurA 434 52 textmining:428
Rv0340 hyp hypothetical protein 682 49 textmining:680
Rv1592c hyp hypothetical protein 833 47 textmining:832
Rv2242 hyp hypothetical protein 626 47 textmining:624
Rv1854c ndh NADH dehydrogenase 548 47 textmining:546

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: ANTAR domain-containing protein
  • Pfam (hmmscan --cut_ga): ANTAR PF03861.20 (E=6e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216288.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ANTAR (PF03861.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 29RFB
  • Curated reference: UniProt O06805 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor Rv1771
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001886|Rv1772|
MGSTGGSQPMTANRGPAAISSGSNSGRVLDTARGILIALRRCPAETAFDELHNAAQRHRLPVFEIAWALVHLAVEGSTPCRSFVDAQSAARREWGQLFAHAAA