Rv1772 Family assigned · medium auto-curated
H37Rv Rv1772 · MTBC0 mtbc0_001886 ·
103 aa · 2024647–2024958 (+) ·
RefSeq NP_216288.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | ANTAR domain-containing protein |
| Revised (this work) | ANTAR domain-containing protein. Pfam: ANTAR (PF03861.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06805
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | ANTAR domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | ANTAR |
| Orthologous group | 29RFB |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.235 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ANTAR | PF03861.20 | 6.3e-09 | 25–70 | ANTAR domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1771 (L-gulono-1,4-lactone dehydrogenase), medium confidence from genomic context alone (score 456 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1771 |
L-gulono-1,4-lactone dehydrogenase | 456 | 456 ctx | neighborhood:453 |
Rv1770 hyp |
hypothetical protein | 456 | 455 ctx | neighborhood:452 |
Rv1769 hyp |
hypothetical protein | 453 | 453 ctx | neighborhood:451 |
Rv0129c fbpC |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 554 | 65 | textmining:543 |
Rv2846c efpA |
MFS-type transporter EfpA | 807 | 64 | textmining:803 |
Rv2245 kasA |
3-oxoacyl-ACP synthase 1 | 547 | 55 | textmining:541 |
Rv1908c katG |
catalase-peroxidase | 446 | 55 | textmining:438 |
Rv2247 accD6 |
acetyl-/propionyl-CoA carboxylase subunit beta | 445 | 55 | textmining:437 |
Rv0341 iniB |
isoniazid inducible protein IniB | 654 | 54 | textmining:650 |
Rv0343 iniC |
iIsoniazid inductible protein IniC | 481 | 52 | textmining:475 |
Rv1909c furA |
ferric uptake regulation protein FurA | 434 | 52 | textmining:428 |
Rv0340 hyp |
hypothetical protein | 682 | 49 | textmining:680 |
Rv1592c hyp |
hypothetical protein | 833 | 47 | textmining:832 |
Rv2242 hyp |
hypothetical protein | 626 | 47 | textmining:624 |
Rv1854c ndh |
NADH dehydrogenase | 548 | 47 | textmining:546 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: ANTAR domain-containing protein
- Pfam (hmmscan --cut_ga): ANTAR PF03861.20 (E=6e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216288.1)
- Domains: Pfam-A via hmmscan --cut_ga — ANTAR (PF03861.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
29RFB - Curated reference: UniProt O06805 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
Rv1771 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001886|Rv1772| MGSTGGSQPMTANRGPAAISSGSNSGRVLDTARGILIALRRCPAETAFDELHNAAQRHRLPVFEIAWALVHLAVEGSTPCRSFVDAQSAARREWGQLFAHAAA