Rv1288 Resolved · high auto-curated

H37Rv Rv1288 · MTBC0 mtbc0_001378 · 456 aa · 1450331–1451701 (+) · RefSeq NP_215804.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationesterase
Revised (this work)Esterase. Pfam: Phage_tail_X (PF05489.19), LysM (PF01476.27), Esterase (PF00756.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM39 SwissProt · reviewed · Evidence at protein level
UniProt nameEsterase Rv1288
EC (curated) EC 3.1.1.-
Curated functionExhibits lipolytic activity with medium chain length esters as optimum substrates. In vitro, pNP-caprylate (C8) is the optimum substrate followed by pNP-capricate (C10). May modulate the cell wall lipids to favor the survival of bacteria under stress conditions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namexynZ
eggNOG descriptionLysin motif
Orthologous groupCOG0627

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.005 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Phage_tail_XPF05489.19 9.6e-067–56 Phage Tail Protein X
LysMPF01476.27 2.6e-09107–152 LysM domain
EsterasePF00756.27 5.0e-60182–442 Putative esterase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1287 (HTH-type transcriptional regulator), medium confidence from genomic context alone (score 668 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1287 HTH-type transcriptional regulator 684 668 ctx neighborhood:645
Rv1289 hyp hypothetical protein 667 667 ctx neighborhood:665
Rv3882c eccE1 ESX-1 secretion system protein EccE1 637 637 ctx cooccurence:637
Rv3594 hyp hypothetical protein 669 627 ctx cooccurence:622
Rv3877 eccD1 ESX-1 secretion system protein EccD1 614 614 ctx cooccurence:614
Rv0097 oxidoreductase 603 603 ctx cooccurence:601
Rv1921c lppF lipoprotein LppF 601 602 ctx cooccurence:533
Rv1754c hyp hypothetical protein 568 541
Rv1285 cysD sulfate adenylyltransferase subunit 2 531 532 ctx neighborhood:505
Rv0899 arfA peptidoglycan-binding protein ArfA 559 531
Rv0412c glnX membrane protein 551 529 coexpression:407
Rv0761c adhB alcohol dehydrogenase B 548 528 coexpression:443
Rv3086 adhD alcohol dehydrogenase D 548 528 coexpression:443
Rv2259 mscR S-nitrosomycothiol reductase MscR 547 527 coexpression:442
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 547 527 coexpression:442

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: esterase
  • Pfam (hmmscan --cut_ga): Phage_tail_X PF05489.19 (E=1e-05), LysM PF01476.27 (E=3e-09), Esterase PF00756.27 (E=5e-60)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215804.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Phage_tail_X (PF05489.19), LysM (PF01476.27), Esterase (PF00756.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0627
  • Curated reference: UniProt P9WM39 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor Rv1287
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001378|Rv1288|
MVSTHAVVAGETLSALALRFYGDAELYRLIAAASGIADPDVVNVGQRLIMPDFTRYTVVAGDTLSALALRFYGDAELNWLIAAASGIADPDVVNVGQRLIMPDFTRYTVVAGDTLSALAARFYGDASLYPLIAAVNGIADPGVIDVGQVLVIFIGRSDGFGLRIVDRNENDPRLWYYRFQTSAIGWNPGVNVLLPDDYRTSGRTYPVLYLFHGGGTDQDFRTFDFLGIRDLTAGKPIIIVMPDGGHAGWYSNPVSSFVGPRNWETFHIAQLLPWIEANFRTYAEYDGRAVAGFSMGGFGALKYAAKYYGHFASASSHSGPASLRRDFGLVVHWANLSSAVLDLGGGTVYGAPLWDQARVSADNPVERIDSYRNKRIFLVAGTSPDPANWFDSVNETQVLAGQREFRERLSNAGIPHESHEVPGGHVFRPDMFRLDLDGIVARLRPASIGAAAERAD