Rv1767 Family assigned · medium auto-curated

H37Rv Rv1767 · MTBC0 mtbc0_001881 · 119 aa · 2018067–2018426 (+) · RefSeq NP_216283.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationcarboxymuconolactone decarboxylase family protein
Revised (this work)Carboxymuconolactone decarboxylase family protein. Pfam: CMD (PF02627.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06800 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionAntioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity
Orthologous groupCOG0599

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.345 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMDPF02627.26 1.0e-2226–106 Carboxymuconolactone decarboxylase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS31 (PE-PGRS family protein PE_PGRS31), medium confidence from genomic context alone (score 455 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1766 hyp hypothetical protein 726 669 ctx neighborhood:659
Rv1768 PE_PGRS31 PE-PGRS family protein PE_PGRS31 724 455 ctx neighborhood:455 textmining:515
Rv1200 integral membrane transport protein 440 441 coexpression:423
Rv0107c ctpI cation-transporter ATPase I 412 413
Rv0751c mmsB 3-hydroxyisobutyrate dehydrogenase 431 408
Rv0770 oxidoreductase 430 407
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 427 372
Rv0777 purB adenylosuccinate lyase PurB 400 320
Rv1997 ctpF cation transporter ATPase F 473 313
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 653 271 textmining:544
Rv3833 AraC family transcriptional regulator 712 265 textmining:625
Rv1747 ABC transporter ATP-binding protein/permease 437 263
Rv1827 garA glycogen accumulation regulator GarA 421 229
Rv0019c fhaB FHA domain-containing protein FhaB 419 227
Rv2533c nusB N utilization substance protein B 531 81 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: carboxymuconolactone decarboxylase family protein
  • Pfam (hmmscan --cut_ga): CMD PF02627.26 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216283.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMD (PF02627.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0599
  • Curated reference: UniProt O06800 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor PE_PGRS31
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001881|Rv1767|
MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVVQGCDGCVASHAQAAVRAGATAQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS