Rv1762c Family assigned · medium auto-curated

H37Rv Rv1762c · MTBC0 mtbc0_001877 · 262 aa · 2013446–2014234 (-) · RefSeq NP_216278.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationheavy metal-binding domain-containing protein
Revised (this work)Heavy metal-binding domain-containing protein. Pfam: YbjQ_1 (PF01906.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06797 SwissProt · reviewed · Evidence at protein level
UniProt nameEncapsulin nanocompartment protein Rv1762c
Curated functionCargo protein of a type 1 encapsulin nanocompartment possibly involved in protection against oxidative stress.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBelongs to the UPF0145 family
Orthologous groupCOG0393

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.207 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.92% of strains (1340) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YbjQ_1PF01906.24 1.1e-08161–244 Putative heavy-metal-binding

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gltB (glutamate synthase large subunit), medium confidence from genomic context alone (score 544 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1761c hyp hypothetical protein 887 887 ctx neighborhood:881
Rv1775 hyp hypothetical protein 553 553 ctx cooccurence:553
Rv3859c gltB glutamate synthase large subunit 544 544 ctx neighborhood:544
Rv2113 integral membrane protein 532 532 ctx cooccurence:532
Rv3903c cpnT hyp hypothetical protein 507 507 ctx cooccurence:507
Rv0538 membrane protein 500 501 ctx cooccurence:500
Rv0090 membrane protein 485 485 ctx cooccurence:483
Rv2729c integral membrane protein 461 461 ctx cooccurence:458
Rv0143c transmembrane protein 452 452 ctx cooccurence:421
Rv2412 rpsT 30S ribosomal protein S20 412 413 coexpression:413
Rv2986c hupB DNA-binding protein HU 407 407 coexpression:405
Rv2856 nicT nickel-transport integral membrane protein NicT 401 401 ctx cooccurence:401
Rv2577 hyp hypothetical protein 400 400 ctx cooccurence:400
Rv1763 Rv1763, (MTCY28.29), len: 108 aa. Putative Transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 tran 917 393 textmining:870
Rv1764 Putative transposase; Rv1764, (MTCY28.30), len: 328 aa. Putative Transposase for IS6110 insertion element. Identical to many other M. tuberc 891 393 textmining:829

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: heavy metal-binding domain-containing protein
  • Pfam (hmmscan --cut_ga): YbjQ_1 PF01906.24 (E=1e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216278.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YbjQ_1 (PF01906.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0393
  • Curated reference: UniProt O06797 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor gltB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001877|Rv1762c|
MQSSSLDPVASERLSHAEKSFTSDLSINEFALLHGAGFEPIELVMGVSVYHVGFQFSGMRQQQELGVLTEATYRARWNAMARMQAEADALKADGIVGVRLNWRHHGEGGEHLEFMAVGTAVRYTAKPGAFRRPNGQAFSSHLSGQDMVTLLRSGFAPVAFVMGNCVFHIAVQGFMQTLRQIGRNMEMPQWTQGNYQARELAMSRMQSEAERDGATGVVGVHFAISNYAWGVHTVEFYTAGTAVRRTGSGETITPSFVLPMDS