Rv1769 Resolved · medium auto-curated

H37Rv Rv1769 · MTBC0 mtbc0_001883 · 414 aa · 2020637–2021881 (+) · RefSeq NP_216285.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationamino acid deaminase/aldolase
Revised (this work)Amino acid deaminase/aldolase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06802 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionAlanine racemase, N-terminal domain
Orthologous groupCOG3616

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.203 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1771 (L-gulono-1,4-lactone dehydrogenase), high confidence from genomic context alone (score 973 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1771 L-gulono-1,4-lactone dehydrogenase 973 973 ctx neighborhood:881 cooccurence:769
Rv1770 hyp hypothetical protein 970 971 ctx neighborhood:881 coexpression:734
Rv1768 PE_PGRS31 PE-PGRS family protein PE_PGRS31 471 471 ctx neighborhood:471
Rv1772 hyp hypothetical protein 453 453 ctx neighborhood:451
Rv0785 KsdD-like steroid dehydrogenase 443 444 ctx cooccurence:442
Rv2004c hyp hypothetical protein 401 402 coexpression:402
Rv0988 hyp hypothetical protein 808 47 textmining:807
Rv2628 hyp hypothetical protein 652 44 textmining:651
Rv0294 tam trans-aconitate methyltransferase 870 41 textmining:870
Rv3019c esxR ESAT-6 like protein EsxR 543 41 textmining:543
Rv3879c espK ESX-1 secretion-associated protein EspK 472 41 textmining:472

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: amino acid deaminase/aldolase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216285.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3616
  • Curated reference: UniProt O06802 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor Rv1771
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001883|Rv1769|
MHEVAAREQRSDGPMRLDAQGRLQRYEEAFADYDAPFAFVDLDAMWGNADQLLARAGDKPIRVASKSLRCRPLQREILDASERFDGLLTFTLTETLWLAGQGFSNLLLAYPPTDRAALRALGELTAKDPDGAPIVMVDSVEHLDLIERTTDKPVRLCLDFDAGYWRAGGRIKIGSKRSPLHTPEQARALAVEIARRPALTLAALMCYEAHIAGLGDNVAGKRVHNAIIRRMQRMSFEELRERRARAVELVREVADIKIVNAGGTGDLQLVAQEPLITEATAGSGFYAPTLFDSYSTFTLQPAAMFALPVCRRPGAKTVTALGGGYLASGVGAKDRMPTPYLPVGLKLNALEGTGEVQTPLSGDAARRLKLGDKVYFRHTKAGELCERFDHLHLVRGAEVVDTVPTYRGEGRTFL