PE_PGRS31 Family assigned · medium auto-curated
H37Rv Rv1768 · MTBC0 - ·
618 aa · 2000614–2002470 (+) ·
RefSeq YP_177832.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE-PGRS family protein PE_PGRS31 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE-PGRS family protein PE_PGRS31. Pfam: PE (PF00934.26), PGRS (PF21526.3). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FK9
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE-PGRS family protein PE_PGRS31 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | COG3391 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.078 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 5 frameshift |
| Disruption | 5 distinct premature-stop/frameshift site(s); most common in 1.23% of strains (1779) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 1.4e-34 | 4–93 | PE family |
PGRS | PF21526.3 | 4.5e-09 | 119–185 | PGRS repeats |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1771 (L-gulono-1,4-lactone dehydrogenase), medium confidence from genomic context alone (score 490 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1771 |
L-gulono-1,4-lactone dehydrogenase | 779 | 490 ctx | neighborhood:473 textmining:585 |
Rv1770 hyp |
hypothetical protein | 471 | 471 ctx | neighborhood:471 |
Rv1769 hyp |
hypothetical protein | 471 | 471 ctx | neighborhood:471 |
Rv1767 hyp |
hypothetical protein | 724 | 455 ctx | neighborhood:455 textmining:515 |
Rv0198c zmp1 |
zinc metalloprotease | 407 | 407 | |
Rv1766 hyp |
hypothetical protein | 684 | 368 | textmining:520 |
Rv1774 |
oxidoreductase | 671 | 76 | textmining:659 |
Rv3436c glmS |
glucosamine--fructose-6-phosphate aminotransferase | 521 | 62 | textmining:511 |
Rv0245 |
oxidoreductase | 547 | 49 | textmining:544 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 454 | 49 | textmining:450 |
Rv1775 hyp |
hypothetical protein | 627 | 41 | textmining:627 |
Rv3435c |
transmembrane protein | 547 | 41 | textmining:547 |
Rv0213c |
methyltransferase | 544 | 41 | textmining:544 |
Rv2529 hyp |
hypothetical protein | 543 | 41 | textmining:543 |
Rv3434c |
transmembrane protein | 540 | 41 | textmining:540 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS31
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-34), PGRS PF21526.3 (E=4e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177832.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3391 - Curated reference: UniProt Q79FK9 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
Rv1771 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1768|PE_PGRS31 MSYLVVVPELVAAAATDLANIGSSISAANAAAAAPTTALVAAGGDEVSAAIAALFGAHARAYQALSAQAAMFHEQFVRALAAGGNSYAVAEAATAQSVQQDLLNLINAPTQALLGRPLIGNGANGLPGTGQNGGDGGILYGNGGNGGSGGVNQAGGNGGNAGLWGNGGSGGAGGNATTAGRNGFNGGAGGSGGLLWGNGGAGGAGGNGGPAPLVGGVGTTGGAGGNGGGAGLFYGFGGAGGNGGMGGVAPSTGPSMGILPAGGVGGPGGSGGASALAFGSGGVGGAGGLGGPTDGTVQGVGGFGGQGGNGGQSGLLFGNAGAGGAGAAGGAGTGDTESFGGHGGAGGDGGAVGLIGNGGAGGTGSPGAVVGGNGGVGGLGGAGSPGGLLYGTGGAGGNGGPGGDGGTGATVGFAGSGGFGGAGGIAQLFGTGGMGGSGGGIGAGTTTVVPPDVAPVGGTGGNGGRAGLLLGVGGMGGNGGATSVGGTLYAAGGNGGDGGLVWGNGGTGGSGGAGGAGSVGNGGAGGNAALLFGNGGAGGAGGAGGIGAGGAGGFGAVLFGNGGAGGSGAPGGIGAGGNGGNALLVGNGGNGGAGTGGAAGGAGGSGGLLFGQNGMPGP