Rv1728c Resolved · high auto-curated

H37Rv Rv1728c · MTBC0 mtbc0_001840 · 256 aa · 1965879–1966649 (-) · RefSeq NP_216244.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationglycoside hydrolase
Revised (this work)Glycoside hydrolase. Pfam: VldE (PF26571.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71986 TrEMBL · unreviewed · Evidence at protein level
UniProt nameARB-07466-like C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionlytic transglycosylase activity
Orthologous groupCOG0741

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.323 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VldEPF26571.1 1.2e-22123–226 VldE, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1729c (S-adenosylmethionine-dependent methyltransferase), high confidence from genomic context alone (score 846 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1729c S-adenosylmethionine-dependent methyltransferase 846 846 ctx neighborhood:799
Rv3658c transmembrane protein 656 656 ctx cooccurence:656
Rv0538 membrane protein 625 625 ctx cooccurence:624
Rv2862c hyp hypothetical protein 584 584 ctx cooccurence:584
Rv1730c penicillin-binding protein 535 535 ctx neighborhood:528
Rv2721c hyp hypothetical protein 529 530 ctx cooccurence:525
Rv0048c membrane protein 518 518 ctx cooccurence:513
Rv1024 membrane protein 489 490 ctx cooccurence:482
Rv3909 hyp hypothetical protein 488 489 ctx cooccurence:481
Rv0227c membrane protein 469 469 ctx cooccurence:464
Rv3732 hyp hypothetical protein 459 460 ctx cooccurence:458
Rv2015c hyp hypothetical protein 457 457 ctx cooccurence:457
Rv2164c hyp hypothetical protein 455 456 ctx cooccurence:449
Rv3882c eccE1 ESX-1 secretion system protein EccE1 448 448 ctx cooccurence:446
Rv3776 hyp hypothetical protein 447 447 ctx cooccurence:447

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: glycoside hydrolase
  • Pfam (hmmscan --cut_ga): VldE PF26571.1 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216244.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VldE (PF26571.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0741
  • Curated reference: UniProt P71986 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv1729c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001840|Rv1728c|
MSVNGLPGAHNAGLQPIDSKGCHTRRTRHTKVLFVSKGVLANGRGRWLAIAASLVVSAAILYAQGAEHTCCRETPAAIPTGPDSAPANAPRIASPTEADLLAASAPVAAQQFQFALPAGVASEEGLQVKTIWVARAVSVLFPQITNIFGYRQDPLKWHPNGLAIDVMIPNHHSDEGIQLGNQVAGLALANAKRWGVLHVIWRQGYYPGIGAPSWTADYGSETLNHYDHVHIATDGGGYPTGRETYYVGSMSPTPPE