Rv1728c Resolved · high auto-curated

H37Rv Rv1728c · MTBC0 mtbc0_001840 · 256 aa · 1965879–1966649 MTBC0 (-) · RefSeq NP_216244.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1714 (Rv1714) — family_assigned: SDR family oxidoreductase Rv1717 (Rv1717) — family_assigned: cupin domain-containing protein Rv1718 (Rv1718) — requalified: 3-keto-5-aminohexanoate cleavage protein Rv1719 (Rv1719) — family_assigned: IclR family transcriptional regulator vapC12 (Rv1720c) — family_assigned: type II toxin-antitoxin system VapC family toxin vapB12 (Rv1721c) — requalified: antitoxin Rv1722 (Rv1722) — requalified: biotin carboxylase Rv1722 Rv1723 (Rv1723) — requalified: serine hydrolase Rv1723 Rv1724c (Rv1724c) — dark: hypothetical protein Rv1725c (Rv1725c) — family_assigned: winged helix-turn-helix transcriptional regulator Rv1726 (Rv1726) — requalified: FAD-binding oxidoreductase Rv1726 Rv1727 (Rv1727) — family_assigned: TIGR03086 family metal-binding protein Rv1728c (Rv1728c) — requalified: glycoside hydrolase Rv1729c (Rv1729c) — requalified: class I SAM-dependent methyltransferase Rv1729c Rv1730c (Rv1730c) — family_assigned: serine hydrolase domain-containing protein Rv1730c gabD2 (Rv1731) — requalified: succinic semialdehyde dehydrogenase gabD2 Rv1732c (Rv1732c) — family_assigned: thioredoxin family protein Rv1733c (Rv1733c) — family_assigned: hypothetical protein narX (Rv1736c) — family_assigned: respiratory nitrate reductase subunit gamma narX narK2 (Rv1737c) — requalified: nitrate transporter NarK narK2 Rv1738 (Rv1738) — family_assigned: DUF1876 domain-containing protein Rv1739c (Rv1739c) — family_assigned: SulP family inorganic anion transporter 1 956 kb 1 960 kb 1 964 kb 1 968 kb 1 972 kb 1 976 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationglycoside hydrolase
Revised (this work)Glycoside hydrolase. Pfam: VldE (PF26571.1).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder38% of residues (metapredict) · mean AlphaFold pLDDT 79.1
Disordered regions1 IDR(s), longest 96 aa [0-96]

carries a substantial disordered region (96/256 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourRv1729c (Rv1729c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.95 (95% CI -0.17 to 2.83). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1757c · 100.0% identity
M. marinum MMAR_2569 · 76.0% identity
M. smegmatis MSMEG_3714 · 69.5% identity
M. orygis RJtmp_001808 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P71986 TrEMBL · unreviewed · Evidence at protein level
UniProt nameARB-07466-like C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionlytic transglycosylase activity
Orthologous groupCOG0741

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.323 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 66.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 20 in the ORF — 0 in the essential state, 0 growth-defect, 20 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 104.85. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance2.52 ppm · rank 3122/3519 (11.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length256 aa
Molecular weight27.2 kDa
Theoretical pI7.18
GRAVY-0.118 (hydrophilic)
Aliphatic index84.3
Aromaticity0.078
Instability index47.4 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VldEPF26571.1 1.2e-22123–226 VldE, C-terminal domain

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv1727 (+ strand, 24 bp gap)
Downstream (3' on genome)Rv1729c (- strand, -4 bp gap)
Predicted operon Rv1728c · Rv1729c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv0047c (activates) · trcR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv1729c (S-adenosylmethionine-dependent methyltransferase), high confidence from genomic context alone (score 846 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1729c S-adenosylmethionine-dependent methyltransferase 846 846 ctx neighborhood:799
Rv3658c transmembrane protein 656 656 ctx cooccurence:656
Rv0538 membrane protein 625 625 ctx cooccurence:624
Rv2862c hyp hypothetical protein 584 584 ctx cooccurence:584
Rv1730c penicillin-binding protein 535 535 ctx neighborhood:528
Rv2721c hyp hypothetical protein 529 530 ctx cooccurence:525
Rv0048c membrane protein 518 518 ctx cooccurence:513
Rv1024 membrane protein 489 490 ctx cooccurence:482
Rv3909 hyp hypothetical protein 488 489 ctx cooccurence:481
Rv0227c membrane protein 469 469 ctx cooccurence:464
Rv3732 hyp hypothetical protein 459 460 ctx cooccurence:458
Rv2015c hyp hypothetical protein 457 457 ctx cooccurence:457
Rv2164c hyp hypothetical protein 455 456 ctx cooccurence:449
Rv3882c eccE1 ESX-1 secretion system protein EccE1 448 448 ctx cooccurence:446
Rv3776 hyp hypothetical protein 447 447 ctx cooccurence:447

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: glycoside hydrolase
  • Pfam (hmmscan --cut_ga): VldE PF26571.1 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216244.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VldE (PF26571.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0741
  • Curated reference: UniProt P71986 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv1729c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001840|Rv1728c|
MSVNGLPGAHNAGLQPIDSKGCHTRRTRHTKVLFVSKGVLANGRGRWLAIAASLVVSAAILYAQGAEHTCCRETPAAIPTGPDSAPANAPRIASPTEADLLAASAPVAAQQFQFALPAGVASEEGLQVKTIWVARAVSVLFPQITNIFGYRQDPLKWHPNGLAIDVMIPNHHSDEGIQLGNQVAGLALANAKRWGVLHVIWRQGYYPGIGAPSWTADYGSETLNHYDHVHIATDGGGYPTGRETYYVGSMSPTPPE