Rv1718 Resolved · high auto-curated

H37Rv Rv1718 · MTBC0 mtbc0_001828 · 272 aa · 1956824–1957642 (+) · RefSeq NP_216234.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation3-keto-5-aminohexanoate cleavage protein
Revised (this work)3-keto-5-aminohexanoate cleavage protein. Pfam: BKACE (PF05853.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71976 TrEMBL · unreviewed · Predicted
UniProt name3-keto-5-aminohexanoate cleavage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionbeta-keto acid cleavage enzyme
Orthologous groupCOG3246

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.532 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 4 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 10.18% of strains (14783) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BKACEPF05853.19 4.8e-913–268 beta-keto acid cleavage enzyme

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadB3 (3-hydroxybutyryl-CoA dehydrogenase FadB), high confidence from genomic context alone (score 972 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1716 hyp hypothetical protein 977 978 ctx neighborhood:808 coexpression:860
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 973 972 ctx neighborhood:808 coexpression:860
Rv1717 hyp hypothetical protein 969 970 ctx neighborhood:717 coexpression:845
Rv1714 oxidoreductase 966 966 ctx neighborhood:808 coexpression:831
Rv1719 transcriptional regulator 935 935 ctx neighborhood:867 coexpression:449
Rv3728 membrane protein 730 730 coexpression:730
Rv1713 engA GTPase Der 482 482 ctx neighborhood:455
Rv1712 cmk cytidylate kinase 471 472 ctx neighborhood:454
Rv1711 RNA pseudouridine synthase 468 468 ctx neighborhood:451
Rv1710 scpB segregation and condensation protein ScpB 459 459 ctx neighborhood:451
Rv1709 scpA segregation and condensation protein ScpA 456 456 ctx neighborhood:449
Rv1708 initiation inhibitor protein 454 454 ctx neighborhood:451
Rv1707 transmembrane protein 433 433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: 3-keto-5-aminohexanoate cleavage protein
  • Pfam (hmmscan --cut_ga): BKACE PF05853.19 (E=5e-91)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216234.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BKACE (PF05853.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3246
  • Curated reference: UniProt P71976 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor fadB3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001828|Rv1718|
MSIVITVAPTGPIATKADNPALPTSPEEIATAVEQAYHAGAAVAHIHLRDENERPTADPNIARRAMDLIGERCPILIQLSTGVGLTVPFEQREQLVELRPRMATLNPCSMSFGAGEFRNPPQAVRRLAARMRELDIKPELEIYDTGHLEACLRLWAEDLLAEPLQFSIVLGVRGGMAATADNLLTMVRRLPPGAIWQVIAIGKANMELTAMGLALGGNARVGLEDTLYLRKGELAPSNLALVSRTIRLAEALDLPIASVEEAEAALQLPGTS