Rv1739c Family assigned · medium auto-curated

H37Rv Rv1739c · MTBC0 mtbc0_001852 · 560 aa · 1978027–1979709 (-) · RefSeq NP_216255.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sulfate ABC transporter permease
MTBC0 PGAP re-annotationSulP family inorganic anion transporter
Revised (this work)SulP family inorganic anion transporter. Pfam: Sulfate_transp (PF00916.27), STAS (PF01740.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGF7 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable sulfate transporter Rv1739c
Curated functionExpression in E.coli induces sulfate uptake during early- to mid-log phase growth. Uptake is maximal at pH 6.0, is sulfate-specific, requires E.coli CysA and the transmembrane segment but not the STAS domain of the protein.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionSulfate transporter
Orthologous groupCOG0659
KEGG orthology K03321
Gene Ontology (86) GO:0000103, GO:0000166, GO:0003333, GO:0003674, GO:0005215, GO:0005310, GO:0005326, GO:0005342, GO:0005488, GO:0005575, GO:0005623, GO:0005886 +74 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 4.175 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 11 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 2.47% of strains (3593) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sulfate_transpPF00916.27 6.0e-11225–392 Sulfate permease family
STASPF01740.27 3.7e-15443–553 STAS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC34 (ribonuclease VapC34), medium confidence from genomic context alone (score 572 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1527c pks5 polyketide synthase 793 782 experimental:772
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 793 781 experimental:772
Rv2940c mas multifunctional mycocerosic acid synthase 792 781 experimental:772
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 792 781 experimental:772
Rv2048c pks12 polyketide synthase 792 781 experimental:772
Rv1663 pks17 polyketide synthase 783 775 experimental:772
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 782 774 experimental:774
Rv0153c ptbB phosphotyrosine protein phosphatase 753 754 experimental:749
Rv1277 hyp hypothetical protein 693 694 experimental:681
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 608 584 experimental:541
Rv1742 hyp hypothetical protein 575 575 ctx neighborhood:570
Rv1741 vapC34 ribonuclease VapC34 572 572 ctx neighborhood:568
Rv1740 vapB34 antitoxin VapB34 566 565 ctx neighborhood:563
Rv3432c gadB glutamate decarboxylase GadB 455 453 database:451
Rv0199 membrane protein 443 422 experimental:419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sulfate ABC transporter permease
  • MTBC0 PGAP product: SulP family inorganic anion transporter
  • Pfam (hmmscan --cut_ga): Sulfate_transp PF00916.27 (E=6e-112), STAS PF01740.27 (E=4e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216255.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sulfate_transp (PF00916.27), STAS (PF01740.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0659
  • Curated reference: UniProt P9WGF7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor vapC34
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001852|Rv1739c|
MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVAGLPPAAGLWASIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGDLRRYAVLAATLGLLVGLICLLAGTARLGFLASLLSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVTRVHWPTFVLAMSVLALLTMLTRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSGLPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACNIAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGALVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLGVFYGVLAAVALSILELLRRVAHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR