Rv1739c Family assigned · medium auto-curated
H37Rv Rv1739c · MTBC0 mtbc0_001852 ·
560 aa · 1978027–1979709 (-) ·
RefSeq NP_216255.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sulfate ABC transporter permease |
|---|---|
| MTBC0 PGAP re-annotation | SulP family inorganic anion transporter |
| Revised (this work) | SulP family inorganic anion transporter. Pfam: Sulfate_transp (PF00916.27), STAS (PF01740.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGF7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable sulfate transporter Rv1739c |
| Curated function | Expression in E.coli induces sulfate uptake during early- to mid-log phase growth. Uptake is maximal at pH 6.0, is sulfate-specific, requires E.coli CysA and the transmembrane segment but not the STAS domain of the protein. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| eggNOG description | Sulfate transporter |
| Orthologous group | COG0659 |
| KEGG orthology |
K03321
|
| Gene Ontology (86) |
GO:0000103, GO:0000166, GO:0003333, GO:0003674, GO:0005215, GO:0005310, GO:0005326, GO:0005342, GO:0005488, GO:0005575, GO:0005623, GO:0005886 +74 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 4.175 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 11 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 2.47% of strains (3593) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Sulfate_transp | PF00916.27 | 6.0e-112 | 25–392 | Sulfate permease family |
STAS | PF01740.27 | 3.7e-15 | 443–553 | STAS domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapC34 (ribonuclease VapC34), medium confidence from genomic context alone (score 572 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1527c pks5 |
polyketide synthase | 793 | 782 | experimental:772 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 793 | 781 | experimental:772 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 792 | 781 | experimental:772 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 792 | 781 | experimental:772 |
Rv2048c pks12 |
polyketide synthase | 792 | 781 | experimental:772 |
Rv1663 pks17 |
polyketide synthase | 783 | 775 | experimental:772 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 782 | 774 | experimental:774 |
Rv0153c ptbB |
phosphotyrosine protein phosphatase | 753 | 754 | experimental:749 |
Rv1277 hyp |
hypothetical protein | 693 | 694 | experimental:681 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 608 | 584 | experimental:541 |
Rv1742 hyp |
hypothetical protein | 575 | 575 ctx | neighborhood:570 |
Rv1741 vapC34 |
ribonuclease VapC34 | 572 | 572 ctx | neighborhood:568 |
Rv1740 vapB34 |
antitoxin VapB34 | 566 | 565 ctx | neighborhood:563 |
Rv3432c gadB |
glutamate decarboxylase GadB | 455 | 453 | database:451 |
Rv0199 |
membrane protein | 443 | 422 | experimental:419 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sulfate ABC transporter permease
- MTBC0 PGAP product: SulP family inorganic anion transporter
- Pfam (hmmscan --cut_ga): Sulfate_transp PF00916.27 (E=6e-112), STAS PF01740.27 (E=4e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216255.1)
- Domains: Pfam-A via hmmscan --cut_ga — Sulfate_transp (PF00916.27), STAS (PF01740.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0659 - Curated reference: UniProt P9WGF7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
35 functional partner(s); context anchor
vapC34 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001852|Rv1739c| MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVAGLPPAAGLWASIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGDLRRYAVLAATLGLLVGLICLLAGTARLGFLASLLSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVTRVHWPTFVLAMSVLALLTMLTRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSGLPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACNIAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGALVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLGVFYGVLAAVALSILELLRRVAHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR