Rv1723 Resolved · high auto-curated

H37Rv Rv1723 · MTBC0 mtbc0_001835 · 415 aa · 1961357–1962604 (+) · RefSeq NP_216239.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hydrolase
MTBC0 PGAP re-annotationserine hydrolase
Revised (this work)Serine hydrolase. Pfam: Beta-lactamase (PF00144.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71981 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable hydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namenylB
eggNOG descriptionBeta-lactamase
Orthologous groupCOG1680

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.287 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (185) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Beta-lactamasePF00144.30 2.6e-4171–387 Beta-lactamase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1722 (carboxylase), high confidence from genomic context alone (score 957 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1722 carboxylase 957 957 ctx neighborhood:882 cooccurence:634
Rv1721c vapB12 antitoxin VapB12 512 512 ctx neighborhood:512
Rv1720c vapC12 ribonuclease VapC12 501 501 ctx neighborhood:498
Rv2305 hyp hypothetical protein 419 419 ctx cooccurence:402
Rv1730c penicillin-binding protein 418 419 ctx cooccurence:415

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hydrolase
  • MTBC0 PGAP product: serine hydrolase
  • Pfam (hmmscan --cut_ga): Beta-lactamase PF00144.30 (E=3e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216239.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Beta-lactamase (PF00144.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1680
  • Curated reference: UniProt P71981 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor Rv1722
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001835|Rv1723|
MSGGVPAGLALDNWLSSPYSHWAFQHVEDFMPTTVIARGTEPVVTLPADNAPIADIGLTSTDGIATTVGAVMAATATDGWAVAHRGALVAEQYLDGLGPRTRHLLFSVSKSLVAAVVGALHGAGAIELDAPVTAYVPALADCGYAGATVRHLLDMRSGVAFSENYDDPAAEIHVREQVIGWAPKRGPDLPATLRDYLLTLRRKSAHGGPFEYRSCETDVLGWICEAAAGQPMPELMSELLWSRIGAQCDATIALDVAGAAGTGIFDGGISACLTDMIRFGSLYLRDGVSLAGQQVVPAAWIADTFDGGPDSRQAFAASPDDNPMPGGMYRNQVWFPYPGSNVALCVGMCGQLIYVNRAAEVVAAKLSTQPHSHEPHMLDTLRAFDAVAHELSGIRSSSTNDPQRPSPPAQEASPG