Rv1724c Still unknown · low
H37Rv Rv1724c · MTBC0 mtbc0_001836 ·
139 aa · 1962647–1963066 (-) ·
RefSeq NP_216240.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical; Foldseek hits non-conclusive (moderate TM). Function unknown. |
Curated reference (UniProt)
| UniProt |
P71982
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.598 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 60.6 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8q8o-assembly1_A-2 |
0.99 | 0.51 | 2.0e-03 sig | 8q8o-assembly1_A-2 PA14_16140 protein: the regulator of an operon involved in the biofilm formation in PA14 P. aeruginosa |
2p9i-assembly1_D |
0.99 | 0.43 | 1.5e-03 sig | 2p9i-assembly1_D Crystal Structure of bovine Arp2/3 Complex co-crystallized with ADP and crosslinked with gluteraldehyde |
3uku-assembly1_D |
0.99 | 0.44 | 1.7e-03 sig | 3uku-assembly1_D Structure of Arp2/3 complex with bound inhibitor CK-869 |
2p9p-assembly1_D |
0.99 | 0.42 | 1.7e-03 sig | 2p9p-assembly1_D Crystal Structure of bovine Arp2/3 complex co-crystallized with ADP |
2p9u-assembly1_D |
0.98 | 0.39 | 1.4e-03 sig | 2p9u-assembly1_D Crystal structure of bovine Arp2/3 complex co-crystallized with AMP-PNP and calcium |
6vu7-assembly1_D |
0.97 | 0.50 | 6.6e-03 sig | 6vu7-assembly1_D Crystal structure of YbjN, a putative transcription regulator from E. coli |
3rse-assembly1_D |
0.97 | 0.40 | 3.2e-03 sig | 3rse-assembly1_D Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex |
1tyq-assembly1_D |
0.96 | 0.41 | 3.2e-03 sig | 1tyq-assembly1_D Crystal structure of Arp2/3 complex with bound ATP and calcium |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1726 (oxidoreductase), medium confidence from genomic context alone (score 596 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1725c hyp |
hypothetical protein | 882 | 882 ctx | neighborhood:882 |
Rv1726 |
oxidoreductase | 595 | 596 ctx | neighborhood:596 |
Rv1727 hyp |
hypothetical protein | 507 | 508 ctx | neighborhood:505 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 8q8o-assembly1_A-2 PA14_16140 protein: the regulator of an operon involved in th (prob 0.99, E=2e-03, TM=0.51)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216240.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P71982 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 60.6, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
3 functional partner(s); context anchor
Rv1726 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001836|Rv1724c| MVGNEENELQDLRNLRRPCFSRAEAPIGVYNGEQAIIVYDLRPVPHWPKYWIQALAKHFQRQLKPSPKIDISLLDDRIRFSVFVSTDVSAKDLCKLDDAVYNAVRNAGRAIENEQAALDHKLAEVRKRRMDTWDESYFR