Rv1724c Still unknown · low

H37Rv Rv1724c · MTBC0 mtbc0_001836 · 139 aa · 1962647–1963066 (-) · RefSeq NP_216240.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical; Foldseek hits non-conclusive (moderate TM). Function unknown.

Curated reference (UniProt)

UniProt P71982 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.598 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 60.6 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8q8o-assembly1_A-2 0.99 0.51 2.0e-03 sig 8q8o-assembly1_A-2 PA14_16140 protein: the regulator of an operon involved in the biofilm formation in PA14 P. aeruginosa
2p9i-assembly1_D 0.99 0.43 1.5e-03 sig 2p9i-assembly1_D Crystal Structure of bovine Arp2/3 Complex co-crystallized with ADP and crosslinked with gluteraldehyde
3uku-assembly1_D 0.99 0.44 1.7e-03 sig 3uku-assembly1_D Structure of Arp2/3 complex with bound inhibitor CK-869
2p9p-assembly1_D 0.99 0.42 1.7e-03 sig 2p9p-assembly1_D Crystal Structure of bovine Arp2/3 complex co-crystallized with ADP
2p9u-assembly1_D 0.98 0.39 1.4e-03 sig 2p9u-assembly1_D Crystal structure of bovine Arp2/3 complex co-crystallized with AMP-PNP and calcium
6vu7-assembly1_D 0.97 0.50 6.6e-03 sig 6vu7-assembly1_D Crystal structure of YbjN, a putative transcription regulator from E. coli
3rse-assembly1_D 0.97 0.40 3.2e-03 sig 3rse-assembly1_D Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
1tyq-assembly1_D 0.96 0.41 3.2e-03 sig 1tyq-assembly1_D Crystal structure of Arp2/3 complex with bound ATP and calcium

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1726 (oxidoreductase), medium confidence from genomic context alone (score 596 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1725c hyp hypothetical protein 882 882 ctx neighborhood:882
Rv1726 oxidoreductase 595 596 ctx neighborhood:596
Rv1727 hyp hypothetical protein 507 508 ctx neighborhood:505

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 8q8o-assembly1_A-2 PA14_16140 protein: the regulator of an operon involved in th (prob 0.99, E=2e-03, TM=0.51)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216240.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P71982 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 60.6, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor Rv1726
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001836|Rv1724c|
MVGNEENELQDLRNLRRPCFSRAEAPIGVYNGEQAIIVYDLRPVPHWPKYWIQALAKHFQRQLKPSPKIDISLLDDRIRFSVFVSTDVSAKDLCKLDDAVYNAVRNAGRAIENEQAALDHKLAEVRKRRMDTWDESYFR