trpG Resolved · high auto-curated

H37Rv Rv0013 · MTBC0 - · 232 aa · 14914–15612 (+) · RefSeq YP_177615.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anthranilate synthase component II
MTBC0 PGAP re-annotation
Revised (this work)Anthranilate synthase component II. Pfam: GATase (PF00117.35), Peptidase_C26 (PF07722.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WN35 SwissProt · reviewed · Evidence at protein level
UniProt nameAnthranilate synthase component 2
EC (curated) EC 4.1.3.27
Curated functionPart of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
H Coenzyme transport and metabolism
Preferred nametrpG
eggNOG descriptionAnthranilate synthase
Orthologous groupCOG0512
EC number EC 2.6.1.85, EC 4.1.3.27
KEGG orthology K01658, K01664
KEGG pathways map00400, map00405, map00790, map01100, map01110, map01130, map01230, map02024, map02025
KEGG modules M00023
Gene Ontology (57) GO:0000162, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0005950, GO:0006082, GO:0006520, GO:0006568, GO:0006576, GO:0006586 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.293 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GATasePF00117.35 8.5e-534–189 Glutamine amidotransferase class-I
Peptidase_C26PF07722.20 5.7e-1157–174 Peptidase C26

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pabB (para-aminobenzoate synthase component I), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1005c pabB para-aminobenzoate synthase component I 999 1000 ctx fusion:900 cooccurence:769 coexpression:696 experimental:788 database:900
Rv1609 trpE anthranilate synthase component I 999 1000 ctx fusion:900 cooccurence:774 coexpression:697 experimental:788 database:900 textmining:897
Rv2192c trpD anthranilate phosphoribosyltransferase 999 998 ctx fusion:900 cooccurence:757 coexpression:857 database:500 textmining:605
Rv1611 trpC indole-3-glycerol phosphate synthase 997 994 ctx fusion:900 cooccurence:761 coexpression:733 textmining:602
Rv2386c mbtI salicylate synthase 996 993 ctx fusion:529 cooccurence:770 coexpression:694 experimental:788 textmining:479
Rv1612 trpB tryptophan synthase subunit beta 975 965 ctx cooccurence:708 coexpression:857
Rv1613 trpA tryptophan synthase subunit alpha 974 964 ctx cooccurence:760 coexpression:819
Rv0812 4-amino-4-deoxychorismate lyase 922 912 database:900
Rv2540c aroF chorismate synthase 917 901 ctx cooccurence:412 database:800
Rv3215 entC isochorismate synthase 897 894 ctx fusion:587 cooccurence:745
Rv0012 membrane protein 829 829 ctx neighborhood:827
Rv1885c chorismate mutase 903 815 database:800 textmining:499
Rv0948c chorismate mutase 928 814 database:800 textmining:629
Rv0011c crgA cell division protein CrgA 749 749 ctx neighborhood:747
Rv1435c hyp hypothetical protein 774 744 coexpression:729

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): anthranilate synthase component II
  • Pfam (hmmscan --cut_ga): GATase PF00117.35 (E=9e-53), Peptidase_C26 PF07722.20 (E=6e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177615.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GATase (PF00117.35), Peptidase_C26 (PF07722.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0512
  • Curated reference: UniProt P9WN35 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor pabB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0013|trpG
MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA