trpG Resolved · high auto-curated
H37Rv Rv0013 · MTBC0 - ·
232 aa · 14914–15612 (+) ·
RefSeq YP_177615.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | anthranilate synthase component II |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Anthranilate synthase component II. Pfam: GATase (PF00117.35), Peptidase_C26 (PF07722.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WN35
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Anthranilate synthase component 2 |
| EC (curated) |
EC 4.1.3.27
|
| Curated function | Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolismH Coenzyme transport and metabolism
|
|---|---|
| Preferred name | trpG |
| eggNOG description | Anthranilate synthase |
| Orthologous group | COG0512 |
| EC number |
EC 2.6.1.85, EC 4.1.3.27
|
| KEGG orthology |
K01658, K01664
|
| KEGG pathways |
map00400, map00405, map00790, map01100, map01110, map01130, map01230, map02024, map02025
|
| KEGG modules |
M00023
|
| Gene Ontology (57) |
GO:0000162, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0005950, GO:0006082, GO:0006520, GO:0006568, GO:0006576, GO:0006586 +45 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.293 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GATase | PF00117.35 | 8.5e-53 | 4–189 | Glutamine amidotransferase class-I |
Peptidase_C26 | PF07722.20 | 5.7e-11 | 57–174 | Peptidase C26 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pabB (para-aminobenzoate synthase component I), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1005c pabB |
para-aminobenzoate synthase component I | 999 | 1000 ctx | fusion:900 cooccurence:769 coexpression:696 experimental:788 database:900 |
Rv1609 trpE |
anthranilate synthase component I | 999 | 1000 ctx | fusion:900 cooccurence:774 coexpression:697 experimental:788 database:900 textmining:897 |
Rv2192c trpD |
anthranilate phosphoribosyltransferase | 999 | 998 ctx | fusion:900 cooccurence:757 coexpression:857 database:500 textmining:605 |
Rv1611 trpC |
indole-3-glycerol phosphate synthase | 997 | 994 ctx | fusion:900 cooccurence:761 coexpression:733 textmining:602 |
Rv2386c mbtI |
salicylate synthase | 996 | 993 ctx | fusion:529 cooccurence:770 coexpression:694 experimental:788 textmining:479 |
Rv1612 trpB |
tryptophan synthase subunit beta | 975 | 965 ctx | cooccurence:708 coexpression:857 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 974 | 964 ctx | cooccurence:760 coexpression:819 |
Rv0812 |
4-amino-4-deoxychorismate lyase | 922 | 912 | database:900 |
Rv2540c aroF |
chorismate synthase | 917 | 901 ctx | cooccurence:412 database:800 |
Rv3215 entC |
isochorismate synthase | 897 | 894 ctx | fusion:587 cooccurence:745 |
Rv0012 |
membrane protein | 829 | 829 ctx | neighborhood:827 |
Rv1885c |
chorismate mutase | 903 | 815 | database:800 textmining:499 |
Rv0948c |
chorismate mutase | 928 | 814 | database:800 textmining:629 |
Rv0011c crgA |
cell division protein CrgA | 749 | 749 ctx | neighborhood:747 |
Rv1435c hyp |
hypothetical protein | 774 | 744 | coexpression:729 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): anthranilate synthase component II
- Pfam (hmmscan --cut_ga): GATase PF00117.35 (E=9e-53), Peptidase_C26 PF07722.20 (E=6e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177615.1)
- Domains: Pfam-A via hmmscan --cut_ga — GATase (PF00117.35), Peptidase_C26 (PF07722.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0512 - Curated reference: UniProt P9WN35 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
pabB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0013|trpG MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA