trpD Resolved · high auto-curated
H37Rv Rv2192c · MTBC0 mtbc0_002328 ·
370 aa ·
2481638–2482750 MTBC0
(-) ·
RefSeq NP_216708.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | anthranilate phosphoribosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | anthranilate phosphoribosyltransferase |
| Revised (this work) | Anthranilate phosphoribosyltransferase. Pfam: Glycos_trans_3N (PF02885.23), Glycos_transf_3 (PF00591.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (9 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Superfast Synthesis of Stabilized Silver Nanoparticles Using Aqueous Allium sativum (Garlic) Extract and Isoniazid Hydrazide Conjugates: Molecular Docking and In-Vitro Characterizations. doi:10.3390/molecules27010110 | 2021 |
| Random insertion transposon mutagenesis of Mycobacterium fortuitum identified mutant defective in biofilm formation. doi:10.1016/j.bbrc.2019.11.021 | 2020 |
| In-silico Metabolome Target Analysis Towards PanC-based Antimycobacterial Agent Discovery. | 2015 |
| Analysis of differentially expressed proteins in late-stationary growth phase of Mycobacterium tuberculosis H37Rv. doi:10.1002/bab.1137 | 2014 |
| Construction of a severely attenuated mutant of Mycobacterium tuberculosis for reducing risk to laboratory workers. doi:10.1016/j.tube.2008.02.008 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 11 % of gene
| Neighbour | dnaQ (Rv2191, + strand) |
|---|---|
| Overlap | 126 bp, 11 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
1 reported modified residue(s):
N-acetylalanine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -7.17 (95% CI -7.67 to -6.66). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Tryptophan biosynthesis |
|---|---|
| Mycobrowser EC |
2.4.2.18
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2215c
· 99.7% identity |
|---|---|
| M. leprae |
ML0883
· 80.7% identity |
| M. marinum |
MMAR_3236
· 79.8% identity |
| M. smegmatis |
MSMEG_4258
· 78.9% identity |
| M. abscessus |
MAB_1970
· 76.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFX5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Anthranilate phosphoribosyltransferase |
| EC (curated) |
EC 2.4.2.18
|
| Curated function | Catalyzes the transfer of the phosphoribosyl group of 5-phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | trpD |
| eggNOG description | Catalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA) |
| Orthologous group | COG0547 |
| EC number |
EC 2.4.2.18
|
| KEGG orthology |
K00766
|
| KEGG pathways |
map00400, map01100, map01110, map01130, map01230
|
| KEGG modules |
M00023
|
| Gene Ontology (58) |
GO:0000162, GO:0003674, GO:0003824, GO:0004048, GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006568, GO:0006576 +46 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.119 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 84.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 50.9% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 7 in the ORF — 7 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv2192c-trpD-TetOn 1.1 (TetON promoter 1) |
|---|---|
| Baseline knockdown fitness | 1.008 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - slow growth (less than 1 doubling in a screening wave)) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -4.81 | 0.0053 | required |
| fitness in mouse infection, day 45 (in vivo) | -4.81 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 46.9 ppm · rank 1798/3519 (48.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 370 aa |
|---|---|
| Molecular weight | 37.7 kDa |
| Theoretical pI | 5.99 |
| GRAVY | 0.196 (hydrophobic) |
| Aliphatic index | 93.0 |
| Aromaticity | 0.049 |
| Instability index | 28.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glycos_trans_3N | PF02885.23 | 2.2e-18 | 29–90 | Glycosyl transferase family, helical bundle domain |
Glycos_transf_3 | PF00591.28 | 5.7e-90 | 101–356 | Glycosyl transferase family, a/b domain |
Experimental structures (Protein Data Bank) 36 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4giu |
X-ray diffraction | 1.667 Å | 100% |
4gkm |
X-ray diffraction | 1.6683 Å | 100% |
3r88 |
X-ray diffraction | 1.73 Å | 100% |
4x58 |
X-ray diffraction | 1.75 Å | 100% |
4x5e |
X-ray diffraction | 1.77 Å | 100% |
4ij1 |
X-ray diffraction | 1.79 Å | 100% |
4x59 |
X-ray diffraction | 1.8 Å | 100% |
5c1r |
X-ray diffraction | 1.802 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (36 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4x58-assembly1_A |
1.00 | 1.00 | 3.0e-56 sig | 4x58-assembly1_A Anthranilate phosphoribosyl transferase variant N138A from Mycobacterium tuberculosis in complex with PRPP and Mg |
5c1r-assembly1_B |
1.00 | 1.00 | 1.9e-55 sig | 5c1r-assembly1_B Stereoisomer of PRPP bound in the active site of Mycobacterium tuberculosis anthranilate phosphoribosyl (AnPRT; trpD) |
4zof-assembly1_B |
1.00 | 1.00 | 4.2e-55 sig | 4zof-assembly1_B Lobenzarit-like inhibitor bound in the active site of Mycobacterium tuberculosis anthranilate phosphoribosyltransferase (AnPRT; trpD) |
4x59-assembly1_B |
1.00 | 1.00 | 1.0e-54 sig | 4x59-assembly1_B Anthranilate phosphoribosyltransferase variant P180A from Mycobacterium tuberculosis in complex with PRPP and Mg |
4owo-assembly1_B |
1.00 | 0.99 | 6.2e-55 sig | 4owo-assembly1_B Anthranilate phosphoribosyl transferase from Mycobacterium tuberculosis in complex with 6-fluoroanthranilate, PRPP and Magnesium |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2191 (+ strand, -126 bp gap) |
|---|---|
| Downstream (3' on genome) | ctaE (+ strand, 157 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: trpG (anthranilate synthase component II), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0013 trpG exp |
anthranilate synthase component II | 999 | 998 ctx | fusion:900 cooccurence:757 coexpression:857 database:500 textmining:605 |
Rv1609 trpE exp |
anthranilate synthase component I | 999 | 998 ctx | cooccurence:768 coexpression:697 experimental:778 database:900 textmining:904 |
Rv2386c mbtI exp |
salicylate synthase | 991 | 984 ctx | cooccurence:762 coexpression:694 experimental:778 textmining:506 |
Rv1611 trpC |
indole-3-glycerol phosphate synthase | 997 | 982 ctx | fusion:674 cooccurence:774 coexpression:734 textmining:871 |
Rv1005c pabB exp |
para-aminobenzoate synthase component I | 982 | 980 ctx | cooccurence:725 coexpression:695 experimental:778 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 994 | 973 ctx | cooccurence:774 coexpression:857 textmining:790 |
Rv1612 trpB |
tryptophan synthase subunit beta | 991 | 973 ctx | cooccurence:772 coexpression:858 textmining:696 |
Rv1603 hisA exp |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 961 | 909 | database:900 textmining:599 |
Rv2193 ctaE |
cytochrome C oxidase subunit III | 859 | 772 ctx | neighborhood:770 textmining:408 |
Rv1435c hyp |
hypothetical protein | 781 | 751 | coexpression:737 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 748 | 748 ctx | neighborhood:733 |
Rv2194 qcrC |
ubiquinol-cytochrome C reductase cytochrome subunit C | 736 | 737 ctx | neighborhood:733 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 736 | 736 ctx | neighborhood:731 |
Rv3215 entC |
isochorismate synthase | 749 | 669 ctx | cooccurence:662 |
Rv2976c ung |
uracil-DNA glycosylase | 592 | 592 ctx | fusion:555 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: anthranilate phosphoribosyltransferase
- MTBC0 PGAP product: anthranilate phosphoribosyltransferase
- Pfam (hmmscan --cut_ga): Glycos_trans_3N PF02885.23 (E=2e-18), Glycos_transf_3 PF00591.28 (E=6e-90)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216708.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glycos_trans_3N (PF02885.23), Glycos_transf_3 (PF00591.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0547 - Curated reference: UniProt P9WFX5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
76 functional partner(s); context anchor
trpG - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002328|Rv2192c|trpD MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for trpD? Email the maintainer — the message is pre-filled with this gene's details.