trpD Resolved · high auto-curated

H37Rv Rv2192c · MTBC0 mtbc0_002328 · 370 aa · 2481638–2482750 (-) · RefSeq NP_216708.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anthranilate phosphoribosyltransferase
MTBC0 PGAP re-annotationanthranilate phosphoribosyltransferase
Revised (this work)Anthranilate phosphoribosyltransferase. Pfam: Glycos_trans_3N (PF02885.23), Glycos_transf_3 (PF00591.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFX5 SwissProt · reviewed · Evidence at protein level
UniProt nameAnthranilate phosphoribosyltransferase
EC (curated) EC 2.4.2.18
Curated functionCatalyzes the transfer of the phosphoribosyl group of 5-phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nametrpD
eggNOG descriptionCatalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'-phosphoribosyl)-anthranilate (PRA)
Orthologous groupCOG0547
EC number EC 2.4.2.18
KEGG orthology K00766
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00023
Gene Ontology (58) GO:0000162, GO:0003674, GO:0003824, GO:0004048, GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006568, GO:0006576 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.119 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glycos_trans_3NPF02885.23 2.2e-1829–90 Glycosyl transferase family, helical bundle domain
Glycos_transf_3PF00591.28 5.7e-90101–356 Glycosyl transferase family, a/b domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trpG (anthranilate synthase component II), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0013 trpG anthranilate synthase component II 999 998 ctx fusion:900 cooccurence:757 coexpression:857 database:500 textmining:605
Rv1609 trpE anthranilate synthase component I 999 998 ctx cooccurence:768 coexpression:697 experimental:778 database:900 textmining:904
Rv2386c mbtI salicylate synthase 991 984 ctx cooccurence:762 coexpression:694 experimental:778 textmining:506
Rv1611 trpC indole-3-glycerol phosphate synthase 997 982 ctx fusion:674 cooccurence:774 coexpression:734 textmining:871
Rv1005c pabB para-aminobenzoate synthase component I 982 980 ctx cooccurence:725 coexpression:695 experimental:778
Rv1613 trpA tryptophan synthase subunit alpha 994 973 ctx cooccurence:774 coexpression:857 textmining:790
Rv1612 trpB tryptophan synthase subunit beta 991 973 ctx cooccurence:772 coexpression:858 textmining:696
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 961 909 database:900 textmining:599
Rv2193 ctaE cytochrome C oxidase subunit III 859 772 ctx neighborhood:770 textmining:408
Rv1435c hyp hypothetical protein 781 751 coexpression:737
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 748 748 ctx neighborhood:733
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 736 737 ctx neighborhood:733
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 736 736 ctx neighborhood:731
Rv3215 entC isochorismate synthase 749 669 ctx cooccurence:662
Rv2976c ung uracil-DNA glycosylase 592 592 ctx fusion:555

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anthranilate phosphoribosyltransferase
  • MTBC0 PGAP product: anthranilate phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): Glycos_trans_3N PF02885.23 (E=2e-18), Glycos_transf_3 PF00591.28 (E=6e-90)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216708.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glycos_trans_3N (PF02885.23), Glycos_transf_3 (PF00591.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0547
  • Curated reference: UniProt P9WFX5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 76 functional partner(s); context anchor trpG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002328|Rv2192c|trpD
MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI