cydB Family assigned · medium auto-curated

H37Rv Rv1622c · MTBC0 mtbc0_001729 · 346 aa · 1835324–1836364 (-) · RefSeq NP_216138.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cytochrome D ubiquinol oxidase subunit II CydB
MTBC0 PGAP re-annotationcytochrome d ubiquinol oxidase subunit II
Revised (this work)Cytochrome d ubiquinol oxidase subunit II. Pfam: Cyt_bd_oxida_II (PF02322.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06139 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable integral membrane cytochrome D ubiquinol oxidase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namecydB
eggNOG descriptioncytochrome D ubiquinol oxidase subunit II
Orthologous groupCOG1294
EC number EC 1.10.3.14
KEGG orthology K00426
KEGG pathways map00190, map01100, map02020
KEGG modules M00153

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.302 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Cyt_bd_oxida_IIPF02322.21 2.7e-973–326 Cytochrome bd terminal oxidase subunit II

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cydA (cytochrome D ubiquinol oxidase subunit I CydA), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1623c cydA cytochrome D ubiquinol oxidase subunit I CydA 999 1000 ctx neighborhood:841 cooccurence:774 coexpression:976 experimental:999 database:540 textmining:966
Rv1621c cydD cytochrome biosyntheisis ABC transporter ATP-binding protein/permease CydD 999 996 ctx neighborhood:782 cooccurence:745 coexpression:942 textmining:948
Rv1620c cydC cytochrome biosyntheisis ABC transporter ATP-binding protein/permease CydC 998 987 ctx neighborhood:782 cooccurence:530 coexpression:884 textmining:887
Rv1624c membrane protein 761 761 ctx neighborhood:743
Rv0558 menH demethylmenaquinone methyltransferase 457 457
Rv1625c cya adenylate cyclase 455 455 ctx neighborhood:447
Rv1854c ndh NADH dehydrogenase 485 275
Rv0392c ndhA NADH dehydrogenase NdhA 441 269
Rv1304 atpB ATP synthase subunit A 538 216 textmining:435
Rv1456c antibiotic ABC transporter permease 424 212
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 402 182
Rv1307 atpH ATP synthase subunit b/delta 468 98 textmining:435
Rv1163 narJ nitrate reductase subunit delta 426 93
Rv1161 narG nitrate reductase subunit alpha 536 91 textmining:511
Rv3043c ctaD cytochrome C oxidase cytochrome 1 467 91 textmining:438

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cytochrome D ubiquinol oxidase subunit II CydB
  • MTBC0 PGAP product: cytochrome d ubiquinol oxidase subunit II
  • Pfam (hmmscan --cut_ga): Cyt_bd_oxida_II PF02322.21 (E=3e-97)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216138.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Cyt_bd_oxida_II (PF02322.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1294
  • Curated reference: UniProt O06139 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor cydA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001729|Rv1622c|cydB
MVLQELWFGVIAALFLGFFILEGFDFGVGMLMAPFAHVGMGDPETHRRTALNTIGPVWDGNEVWLITAGAAIFAAFPGWYATVFSALYLPLLAILFGMILRAVAIEWRGKIDDPKWRTGADFGIAAGSWLPALLWGVAFAILVRGLPVDANGHVALSIPDVLNAYTLLGGLATAGLFSLYGAVFIALKTSGPIRDDAYRFAVWLSLPVAGLVAGFGLWTQLAYGKDWTWLVLAVAGCAQAAATVLVWRRVSDGWAFMCTLIVVAAVVVLLFGALYPNLVPSTLNPQWSLTIHNASSTPYTLKIMTWVTAFFAPLTVAYQTWTYWVFRQRISAERIPPPTGLARRAP