plsC Family assigned · medium auto-curated
H37Rv Rv2483c · MTBC0 mtbc0_002643 ·
580 aa ·
2812170–2813912 MTBC0
(-) ·
RefSeq NP_216999.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | HAD-IB family hydrolase |
| Revised (this work) | HAD-IB family hydrolase. Pfam: HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Identification of a 1-acyl-glycerol-3-phosphate acyltransferase from Mycobacterium tuberculosis, a key enzyme involved in triacylglycerol biosynthesis. doi:10.1111/mmi.15265 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | plsB (Rv2482c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.72 (95% CI -2.39 to 5.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | C-terminus: involved in phospholipid biosynthesis (at the second step); converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position [catalytic activity 2: acyl-CoA + 1-acyl-SN-glycerol 3-phosphate = CoA + 1,2-diacyl-SN-glycerol 3-phosphate]. N-terminus: could be generate serine and phosphate from phosphoserine; may catalyze the last step in the biosyn |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2508c
· 99.8% identity |
|---|---|
| M. leprae |
ML1245
· 83.3% identity |
| M. marinum |
MMAR_3834
· 89.9% identity |
| M. smegmatis |
MSMEG_4704
· 72.4% identity |
| M. orygis |
RJtmp_002567
· 99.8% identity |
| M. abscessus |
MAB_2455c
· 53.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YDI9
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phospholipid/glycerol acyltransferase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolismI Lipid transport and metabolism
|
|---|---|
| Preferred name | plsC |
| eggNOG description | HAD-superfamily subfamily IB hydrolase, TIGR01490 |
| Orthologous group | COG0204 |
| EC number |
EC 2.3.1.51, EC 3.1.3.3
|
| KEGG orthology |
K00655, K15781
|
| KEGG pathways |
map00561, map00564, map01100, map01110
|
| KEGG modules |
M00089
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.411 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 7 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (221) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.176 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 39.7% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 27 in the ORF — 0 in the essential state, 0 growth-defect, 27 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 51. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 39.7 ppm · rank 1906/3519 (45.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 580 aa |
|---|---|
| Molecular weight | 61.7 kDa |
| Theoretical pI | 9.64 |
| GRAVY | -0.077 (hydrophilic) |
| Aliphatic index | 95.8 |
| Aromaticity | 0.052 |
| Instability index | 36.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HAD | PF12710.14 | 4.5e-27 | 40–223 | haloacid dehalogenase-like hydrolase |
Hydrolase | PF00702.33 | 1.2e-06 | 40–220 | haloacid dehalogenase-like hydrolase |
Acyltransferase | PF01553.27 | 5.8e-33 | 313–438 | Acyltransferase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 77.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3fvv-assembly1_A |
1.00 | 0.88 | 9.1e-13 sig | 3fvv-assembly1_A The crystal structure of the protein with unknown function from Bordetella pertussis Tohama I |
5kym-assembly2_B |
1.00 | 0.78 | 6.1e-13 sig | 5kym-assembly2_B Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima |
5jlp-assembly1_A |
1.00 | 0.73 | 1.4e-12 sig | 5jlp-assembly1_A Crystal structure of Mycobacterium avium SerB2 in complex with serine at ACT domain |
5is2-assembly1_A-2 |
1.00 | 0.73 | 1.7e-12 sig | 5is2-assembly1_A-2 Crystal structure of Mycobacterium avium SerB2 at pH 6.6 |
5kym-assembly1_A |
1.00 | 0.78 | 1.6e-12 sig | 5kym-assembly1_A Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima |
Foldseek search of the AlphaFold DB model (mean pLDDT 77.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | plsB2 (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2484c (- strand, -4 bp gap) |
| Predicted operon |
Rv2481c · plsB2 · plsC · Rv2484c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2484c (diacyglycerol O-acyltransferase), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2484c |
diacyglycerol O-acyltransferase | 996 | 995 ctx | neighborhood:882 cooccurence:657 coexpression:833 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 996 | 991 ctx | neighborhood:881 cooccurence:753 coexpression:733 textmining:595 |
Rv2481c hyp |
hypothetical protein | 757 | 756 ctx | neighborhood:749 |
Rv1551 plsB1 |
acyltransferase PlsB | 821 | 711 ctx | cooccurence:664 textmining:407 |
Rv1605 hisF |
imidazole glycerol phosphate synthase subunit HisF | 630 | 595 | coexpression:572 |
Rv2477c ettA |
macrolide ABC transporter ATP-binding protein | 569 | 553 ctx | neighborhood:484 |
Rv2478c hyp |
hypothetical protein | 550 | 544 ctx | neighborhood:544 |
Rv0332 hyp |
hypothetical protein | 536 | 536 ctx | cooccurence:533 |
Rv1602 hisH |
imidazole glycerol phosphate synthase subunit HisH | 557 | 530 | coexpression:502 |
Rv1203c hyp |
hypothetical protein | 528 | 529 ctx | cooccurence:527 |
Rv1603 hisA |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 549 | 526 | coexpression:492 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 579 | 513 | coexpression:468 |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 533 | 501 | coexpression:472 |
Rv2524c fas |
fatty acid synthase | 653 | 489 | |
Rv0425c ctpH exp |
metal cation transporting ATPase H | 510 | 488 | database:451 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
- MTBC0 PGAP product: HAD-IB family hydrolase
- Pfam (hmmscan --cut_ga): HAD PF12710.14 (E=5e-27), Hydrolase PF00702.33 (E=1e-06), Acyltransferase PF01553.27 (E=6e-33)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216999.1)
- Domains: Pfam-A via hmmscan --cut_ga — HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0204 - Curated reference: UniProt I6YDI9 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 77.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
Rv2484c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002643|Rv2483c|plsC MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQERLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTGGVLKPILWGPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIAEVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGAAATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for plsC? Email the maintainer — the message is pre-filled with this gene's details.