plsC Family assigned · medium auto-curated

H37Rv Rv2483c · MTBC0 mtbc0_002643 · 580 aa · 2812170–2813912 (-) · RefSeq NP_216999.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
MTBC0 PGAP re-annotationHAD-IB family hydrolase
Revised (this work)HAD-IB family hydrolase. Pfam: HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YDI9 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhospholipid/glycerol acyltransferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
I Lipid transport and metabolism
Preferred nameplsC
eggNOG descriptionHAD-superfamily subfamily IB hydrolase, TIGR01490
Orthologous groupCOG0204
EC number EC 2.3.1.51, EC 3.1.3.3
KEGG orthology K00655, K15781
KEGG pathways map00561, map00564, map01100, map01110
KEGG modules M00089

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.411 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (221) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HADPF12710.14 4.5e-2740–223 haloacid dehalogenase-like hydrolase
HydrolasePF00702.33 1.2e-0640–220 haloacid dehalogenase-like hydrolase
AcyltransferasePF01553.27 5.8e-33313–438 Acyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2484c (diacyglycerol O-acyltransferase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2484c diacyglycerol O-acyltransferase 996 995 ctx neighborhood:882 cooccurence:657 coexpression:833
Rv2482c plsB2 glycerol-3-phosphate acyltransferase 996 991 ctx neighborhood:881 cooccurence:753 coexpression:733 textmining:595
Rv2481c hyp hypothetical protein 757 756 ctx neighborhood:749
Rv1551 plsB1 acyltransferase PlsB 821 711 ctx cooccurence:664 textmining:407
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 630 595 coexpression:572
Rv2477c ettA macrolide ABC transporter ATP-binding protein 569 553 ctx neighborhood:484
Rv2478c hyp hypothetical protein 550 544 ctx neighborhood:544
Rv0332 hyp hypothetical protein 536 536 ctx cooccurence:533
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 557 530 coexpression:502
Rv1203c hyp hypothetical protein 528 529 ctx cooccurence:527
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 549 526 coexpression:492
Rv1601 hisB imidazole glycerol-phosphate dehydratase 579 513 coexpression:468
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 533 501 coexpression:472
Rv2524c fas fatty acid synthase 653 489
Rv0425c ctpH metal cation transporting ATPase H 510 488 database:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
  • MTBC0 PGAP product: HAD-IB family hydrolase
  • Pfam (hmmscan --cut_ga): HAD PF12710.14 (E=5e-27), Hydrolase PF00702.33 (E=1e-06), Acyltransferase PF01553.27 (E=6e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216999.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt I6YDI9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor Rv2484c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002643|Rv2483c|plsC
MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQERLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTGGVLKPILWGPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIAEVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGAAATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS