plsC Family assigned · medium auto-curated

H37Rv Rv2483c · MTBC0 mtbc0_002643 · 580 aa · 2812170–2813912 MTBC0 (-) · RefSeq NP_216999.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
MTBC0 PGAP re-annotationHAD-IB family hydrolase
Revised (this work)HAD-IB family hydrolase. Pfam: HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27).
Functional category (TubercuList)lipid metabolism

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Identification of a 1-acyl-glycerol-3-phosphate acyltransferase from Mycobacterium tuberculosis, a key enzyme involved in triacylglycerol biosynthesis. doi:10.1111/mmi.15265 2024

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourplsB (Rv2482c, - strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.72 (95% CI -2.39 to 5.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionC-terminus: involved in phospholipid biosynthesis (at the second step); converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position [catalytic activity 2: acyl-CoA + 1-acyl-SN-glycerol 3-phosphate = CoA + 1,2-diacyl-SN-glycerol 3-phosphate]. N-terminus: could be generate serine and phosphate from phosphoserine; may catalyze the last step in the biosyn

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2508c · 99.8% identity
M. leprae ML1245 · 83.3% identity
M. marinum MMAR_3834 · 89.9% identity
M. smegmatis MSMEG_4704 · 72.4% identity
M. orygis RJtmp_002567 · 99.8% identity
M. abscessus MAB_2455c · 53.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6YDI9 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhospholipid/glycerol acyltransferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
I Lipid transport and metabolism
Preferred nameplsC
eggNOG descriptionHAD-superfamily subfamily IB hydrolase, TIGR01490
Orthologous groupCOG0204
EC number EC 2.3.1.51, EC 3.1.3.3
KEGG orthology K00655, K15781
KEGG pathways map00561, map00564, map01100, map01110
KEGG modules M00089

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.411 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (221) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.176 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 85.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 39.7%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 27 in the ORF — 0 in the essential state, 0 growth-defect, 27 non-essential, 0 growth-advantage. Saturation 0.889, mean read count 51. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance39.7 ppm · rank 1906/3519 (45.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length580 aa
Molecular weight61.7 kDa
Theoretical pI9.64
GRAVY-0.077 (hydrophilic)
Aliphatic index95.8
Aromaticity0.052
Instability index36.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HADPF12710.14 4.5e-2740–223 haloacid dehalogenase-like hydrolase
HydrolasePF00702.33 1.2e-0640–220 haloacid dehalogenase-like hydrolase
AcyltransferasePF01553.27 5.8e-33313–438 Acyltransferase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 77.8

PDB hitprobTM-scoreE-valueDescription
3fvv-assembly1_A 1.00 0.88 9.1e-13 sig 3fvv-assembly1_A The crystal structure of the protein with unknown function from Bordetella pertussis Tohama I
5kym-assembly2_B 1.00 0.78 6.1e-13 sig 5kym-assembly2_B Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima
5jlp-assembly1_A 1.00 0.73 1.4e-12 sig 5jlp-assembly1_A Crystal structure of Mycobacterium avium SerB2 in complex with serine at ACT domain
5is2-assembly1_A-2 1.00 0.73 1.7e-12 sig 5is2-assembly1_A-2 Crystal structure of Mycobacterium avium SerB2 at pH 6.6
5kym-assembly1_A 1.00 0.78 1.6e-12 sig 5kym-assembly1_A Crystal Structure of the 1-acyl-sn-glycerophosphate (LPA) acyltransferase, PlsC, from Thermotoga maritima

Foldseek search of the AlphaFold DB model (mean pLDDT 77.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)plsB2 (- strand, -4 bp gap)
Downstream (3' on genome)Rv2484c (- strand, -4 bp gap)
Predicted operon Rv2481c · plsB2 · plsC · Rv2484c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2484c (diacyglycerol O-acyltransferase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2484c diacyglycerol O-acyltransferase 996 995 ctx neighborhood:882 cooccurence:657 coexpression:833
Rv2482c plsB2 glycerol-3-phosphate acyltransferase 996 991 ctx neighborhood:881 cooccurence:753 coexpression:733 textmining:595
Rv2481c hyp hypothetical protein 757 756 ctx neighborhood:749
Rv1551 plsB1 acyltransferase PlsB 821 711 ctx cooccurence:664 textmining:407
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 630 595 coexpression:572
Rv2477c ettA macrolide ABC transporter ATP-binding protein 569 553 ctx neighborhood:484
Rv2478c hyp hypothetical protein 550 544 ctx neighborhood:544
Rv0332 hyp hypothetical protein 536 536 ctx cooccurence:533
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 557 530 coexpression:502
Rv1203c hyp hypothetical protein 528 529 ctx cooccurence:527
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 549 526 coexpression:492
Rv1601 hisB imidazole glycerol-phosphate dehydratase 579 513 coexpression:468
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 533 501 coexpression:472
Rv2524c fas fatty acid synthase 653 489
Rv0425c ctpH exp metal cation transporting ATPase H 510 488 database:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
  • MTBC0 PGAP product: HAD-IB family hydrolase
  • Pfam (hmmscan --cut_ga): HAD PF12710.14 (E=5e-27), Hydrolase PF00702.33 (E=1e-06), Acyltransferase PF01553.27 (E=6e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216999.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HAD (PF12710.14), Hydrolase (PF00702.33), Acyltransferase (PF01553.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt I6YDI9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 77.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor Rv2484c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002643|Rv2483c|plsC
MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQERLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTGGVLKPILWGPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIAEVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGAAATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS