espI Family assigned · medium auto-curated
H37Rv Rv3876 · MTBC0 mtbc0_004110 ·
531 aa · 4377625–4379220 (+) ·
RefSeq NP_218393.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESX-1 secretion-associated protein EspI |
|---|---|
| MTBC0 PGAP re-annotation | MinD/ParA family protein |
| Revised (this work) | MinD/ParA family protein. Pfam: CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJC5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESX-1 secretion-associated protein EspI |
| Curated function | Required to repress ESX-1-mediated secretion under low ATP conditions. This function requires the ATP-binding motif. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| eggNOG description | involved in chromosome partitioning |
| Orthologous group | COG0455 |
| Gene Ontology (29) |
GO:0002790, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0008104, GO:0008150, GO:0009306, GO:0009405, GO:0009987, GO:0015031, GO:0015833 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.726 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 8 synonymous, 16 missense, 0 nonsense, 7 frameshift |
| Disruption | 7 distinct premature-stop/frameshift site(s); most common in 5.98% of strains (8682) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CbiA | PF01656.30 | 1.7e-10 | 284–493 | CobQ/CobB/MinD/ParA nucleotide binding domain |
AAA_31 | PF13614.13 | 7.4e-08 | 284–370 | AAA domain |
ArsA_ATPase | PF02374.22 | 1.2e-05 | 284–341 | Anion-transporting ATPase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: eccD1 (ESX-1 secretion system protein EccD1), high confidence from genomic context alone (score 988 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3877 eccD1 |
ESX-1 secretion system protein EccD1 | 997 | 988 ctx | neighborhood:881 cooccurence:524 coexpression:798 textmining:808 |
Rv3864 espE |
ESX-1 secretion-associated protein EspE | 941 | 884 ctx | cooccurence:436 coexpression:774 textmining:518 |
Rv3878 espJ |
ESX-1 secretion-associated protein EspJ | 963 | 824 ctx | neighborhood:748 textmining:803 |
Rv3875 esxA |
ESAT-6 protein EsxA | 954 | 754 ctx | neighborhood:592 textmining:822 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 939 | 707 ctx | neighborhood:509 textmining:803 |
Rv3873 PPE68 |
PPE family protein PPE68 | 811 | 627 | coexpression:449 textmining:515 |
Rv3869 eccB1 |
ESX-1 secretion system protein EccB | 835 | 567 ctx | cooccurence:441 textmining:635 |
Rv3879c espK |
ESX-1 secretion-associated protein EspK | 908 | 538 ctx | cooccurence:528 textmining:810 |
Rv2542 hyp |
hypothetical protein | 690 | 537 ctx | cooccurence:536 |
Rv3870 eccCa1 |
ESX-1 secretion system protein EccCa | 746 | 521 ctx | cooccurence:402 textmining:493 |
Rv3871 eccCb1 |
ESX-1 secretion system protein EccCb | 902 | 505 | textmining:811 |
Rv3866 espG1 |
ESX-1 secretion-associated protein EspG | 703 | 500 | coexpression:404 textmining:431 |
Rv3882c eccE1 |
ESX-1 secretion system protein EccE1 | 702 | 497 ctx | cooccurence:475 textmining:433 |
Rv3883c mycP1 |
membrane-anchored mycosin | 596 | 474 ctx | cooccurence:461 |
Rv2608 PPE42 |
PPE family protein PPE42 | 469 | 470 ctx | cooccurence:469 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESX-1 secretion-associated protein EspI
- MTBC0 PGAP product: MinD/ParA family protein
- Pfam (hmmscan --cut_ga): CbiA PF01656.30 (E=2e-10), AAA_31 PF13614.13 (E=7e-08), ArsA_ATPase PF02374.22 (E=1e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218393.1)
- Domains: Pfam-A via hmmscan --cut_ga — CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0455 - Curated reference: UniProt P9WJC5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
eccD1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004110|Rv3876|espI MPIAGPAPTPTESQLAPPRPPTPQTPTGAPQQPESPAPHVPSHGPHQPRRTAPAPPWAKMPIGEPPPAPSRPSASPAEPPTRPAPQHSRRARRGHRYRTDTERNVGKVATGPSIQARLRAEEASGAQLAPGTEPSPAPLGQPRSYLAPPTRPAPTEPPPSPSPQRNSGRRAERRVHPDLAAQHAAAQPDSITAATTGGRRRKRAAPDLDATQKSLRPAAKGPKVKKVKPQKPKATKPPKVVSQRGWRHWVHALTRINLGLSPDEKYELDLHARVRRNPRGSYQIAVVGLKGGAGKTTLTAALGSTLAQVRADRILALDADPGAGNLADRVGRQSGATIADVLAEKELSHYNDIRAHTSVNAVNLEVLPAPEYSSAQRALSDADWHFIADPASRFYNLVLADCGAGFFDPLTRGVLSTVSGVVVVASVSIDGAQQASVALDWLRNNGYQDLASRACVVINHIMPGEPNVAVKDLVRHFEQQVQPGRVVVMPWDRHIAAGTEISLDLLDPIYKRKVLELAAALSDDFERAGRR