espI Family assigned · medium auto-curated

H37Rv Rv3876 · MTBC0 mtbc0_004110 · 531 aa · 4377625–4379220 (+) · RefSeq NP_218393.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspI
MTBC0 PGAP re-annotationMinD/ParA family protein
Revised (this work)MinD/ParA family protein. Pfam: CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJC5 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspI
Curated functionRequired to repress ESX-1-mediated secretion under low ATP conditions. This function requires the ATP-binding motif.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
eggNOG descriptioninvolved in chromosome partitioning
Orthologous groupCOG0455
Gene Ontology (29) GO:0002790, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0008104, GO:0008150, GO:0009306, GO:0009405, GO:0009987, GO:0015031, GO:0015833 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.726 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 16 missense, 0 nonsense, 7 frameshift
Disruption 7 distinct premature-stop/frameshift site(s); most common in 5.98% of strains (8682) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CbiAPF01656.30 1.7e-10284–493 CobQ/CobB/MinD/ParA nucleotide binding domain
AAA_31PF13614.13 7.4e-08284–370 AAA domain
ArsA_ATPasePF02374.22 1.2e-05284–341 Anion-transporting ATPase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccD1 (ESX-1 secretion system protein EccD1), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3877 eccD1 ESX-1 secretion system protein EccD1 997 988 ctx neighborhood:881 cooccurence:524 coexpression:798 textmining:808
Rv3864 espE ESX-1 secretion-associated protein EspE 941 884 ctx cooccurence:436 coexpression:774 textmining:518
Rv3878 espJ ESX-1 secretion-associated protein EspJ 963 824 ctx neighborhood:748 textmining:803
Rv3875 esxA ESAT-6 protein EsxA 954 754 ctx neighborhood:592 textmining:822
Rv3874 esxB ESAT-6-like protein EsxB 939 707 ctx neighborhood:509 textmining:803
Rv3873 PPE68 PPE family protein PPE68 811 627 coexpression:449 textmining:515
Rv3869 eccB1 ESX-1 secretion system protein EccB 835 567 ctx cooccurence:441 textmining:635
Rv3879c espK ESX-1 secretion-associated protein EspK 908 538 ctx cooccurence:528 textmining:810
Rv2542 hyp hypothetical protein 690 537 ctx cooccurence:536
Rv3870 eccCa1 ESX-1 secretion system protein EccCa 746 521 ctx cooccurence:402 textmining:493
Rv3871 eccCb1 ESX-1 secretion system protein EccCb 902 505 textmining:811
Rv3866 espG1 ESX-1 secretion-associated protein EspG 703 500 coexpression:404 textmining:431
Rv3882c eccE1 ESX-1 secretion system protein EccE1 702 497 ctx cooccurence:475 textmining:433
Rv3883c mycP1 membrane-anchored mycosin 596 474 ctx cooccurence:461
Rv2608 PPE42 PPE family protein PPE42 469 470 ctx cooccurence:469

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspI
  • MTBC0 PGAP product: MinD/ParA family protein
  • Pfam (hmmscan --cut_ga): CbiA PF01656.30 (E=2e-10), AAA_31 PF13614.13 (E=7e-08), ArsA_ATPase PF02374.22 (E=1e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218393.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0455
  • Curated reference: UniProt P9WJC5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor eccD1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004110|Rv3876|espI
MPIAGPAPTPTESQLAPPRPPTPQTPTGAPQQPESPAPHVPSHGPHQPRRTAPAPPWAKMPIGEPPPAPSRPSASPAEPPTRPAPQHSRRARRGHRYRTDTERNVGKVATGPSIQARLRAEEASGAQLAPGTEPSPAPLGQPRSYLAPPTRPAPTEPPPSPSPQRNSGRRAERRVHPDLAAQHAAAQPDSITAATTGGRRRKRAAPDLDATQKSLRPAAKGPKVKKVKPQKPKATKPPKVVSQRGWRHWVHALTRINLGLSPDEKYELDLHARVRRNPRGSYQIAVVGLKGGAGKTTLTAALGSTLAQVRADRILALDADPGAGNLADRVGRQSGATIADVLAEKELSHYNDIRAHTSVNAVNLEVLPAPEYSSAQRALSDADWHFIADPASRFYNLVLADCGAGFFDPLTRGVLSTVSGVVVVASVSIDGAQQASVALDWLRNNGYQDLASRACVVINHIMPGEPNVAVKDLVRHFEQQVQPGRVVVMPWDRHIAAGTEISLDLLDPIYKRKVLELAAALSDDFERAGRR