espI Family assigned · medium auto-curated

H37Rv Rv3876 · MTBC0 mtbc0_004110 · 531 aa · 4377625–4379220 MTBC0 (+) · RefSeq NP_218393.1

Non-canonical microproteins (overlapping smORFs)

2 MS-proven microproteins from the separate microproteome track overlap this locus (existence proven, function unknown; not counted among the canonical genes).

MicroproteinRelationshipLengthEssentiality
gORF_122227 same-strand overlap (alternative frame) 91 aa
tORF_103888 same-strand overlap (alternative frame) 91 aa

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspI
MTBC0 PGAP re-annotationMinD/ParA family protein
Revised (this work)MinD/ParA family protein. Pfam: CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 8 publications

8 TB publications mention this gene. 8 publication(s) discuss this gene (7 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).

Most recent 5 of 8.
PublicationDate
Localization of EccA3 at the growing pole in Mycobacterium smegmatis. doi:10.1186/s12866-022-02554-6 2022
Recombinant preparation and functional studies of EspI ATP binding domain from Mycobacterium tuberculosis. doi:10.1016/j.pep.2016.03.009 2016
Identification of Novel RD1 Antigens and Their Combinations for Diagnosis of Sputum Smear-/Culture+ TB Patients. doi:10.1155/2016/7486425 2016
EspI regulates the ESX-1 secretion system in response to ATP levels in Mycobacterium tuberculosis. doi:10.1111/mmi.12718 2014
Identification, diagnostic potential, and natural expression of immunodominant seroreactive peptides encoded by five Mycobacterium tuberculosis-specific genomic regions. doi:10.1128/CVI.00405-10 2011

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder45% of residues (metapredict) · mean AlphaFold pLDDT 65.7
Disordered regions1 IDR(s), longest 240 aa [0-240]

carries a substantial disordered region (240/531 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighboureccD1 (Rv3877, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB6 (whiB6).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.31 (95% CI -0.47 to 4.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3906 · 100.0% identity
M. leprae ML0048c · 55.9% identity
M. marinum MMAR_5451 · 56.2% identity
M. smegmatis MSMEG_0067 · 67.6% identity
M. orygis RJtmp_003992 · 99.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WJC5 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspI
Curated functionRequired to repress ESX-1-mediated secretion under low ATP conditions. This function requires the ATP-binding motif.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
eggNOG descriptioninvolved in chromosome partitioning
Orthologous groupCOG0455
Gene Ontology (29) GO:0002790, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0008104, GO:0008150, GO:0009306, GO:0009405, GO:0009987, GO:0015031, GO:0015833 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.726 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 16 missense, 0 nonsense, 7 frameshift
Disruption 7 distinct premature-stop/frameshift site(s); most common in 5.98% of strains (8682) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.545 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 61.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 38.1%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD1mic 76% Microti
RD1mon 34% Microti

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 25 in the ORF — 0 in the essential state, 0 growth-defect, 25 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 186.44. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -3.290.0 required
fitness in mouse infection (in vivo) -3.110.0 required
fitness in mouse infection (in vivo) -3.050.0 required
fitness in mouse infection (in vivo) -3.020.0 required
fitness in mouse infection (in vivo) -2.990.0 required
fitness in mouse infection (in vivo) -2.950.0 required
fitness in mouse infection (in vivo) -2.820.0 required
fitness in mouse infection (in vivo) -2.800.0 required
fitness in mouse infection (in vivo) -2.780.0 required
fitness in mouse infection (in vivo) -2.750.0 required
fitness in mouse infection (in vivo) -2.720.0 required
fitness in mouse infection (in vivo) -2.720.0 required

Conditional fitness of transposon-disruption mutants across 70 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance157.0 ppm · rank 994/3519 (71.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length531 aa
Molecular weight56.9 kDa
Theoretical pI10.23
GRAVY-0.571 (hydrophilic)
Aliphatic index74.5
Aromaticity0.04
Instability index60.9 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CbiAPF01656.30 1.7e-10284–493 CobQ/CobB/MinD/ParA nucleotide binding domain
AAA_31PF13614.13 7.4e-08284–370 AAA domain
ArsA_ATPasePF02374.22 1.2e-05284–341 Anion-transporting ATPase

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)esxA (+ strand, 113 bp gap)
Downstream (3' on genome)eccD1 (+ strand, -4 bp gap)
Predicted operon espI · eccD1

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0023 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: eccD1 (ESX-1 secretion system protein EccD1), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3877 eccD1 ESX-1 secretion system protein EccD1 997 988 ctx neighborhood:881 cooccurence:524 coexpression:798 textmining:808
Rv3864 espE ESX-1 secretion-associated protein EspE 941 884 ctx cooccurence:436 coexpression:774 textmining:518
Rv3878 espJ ESX-1 secretion-associated protein EspJ 963 824 ctx neighborhood:748 textmining:803
Rv3875 esxA ESAT-6 protein EsxA 954 754 ctx neighborhood:592 textmining:822
Rv3874 esxB ESAT-6-like protein EsxB 939 707 ctx neighborhood:509 textmining:803
Rv3873 PPE68 PPE family protein PPE68 811 627 coexpression:449 textmining:515
Rv3869 eccB1 ESX-1 secretion system protein EccB 835 567 ctx cooccurence:441 textmining:635
Rv3879c espK ESX-1 secretion-associated protein EspK 908 538 ctx cooccurence:528 textmining:810
Rv2542 hyp hypothetical protein 690 537 ctx cooccurence:536
Rv3870 eccCa1 ESX-1 secretion system protein EccCa 746 521 ctx cooccurence:402 textmining:493
Rv3871 eccCb1 ESX-1 secretion system protein EccCb 902 505 textmining:811
Rv3866 espG1 ESX-1 secretion-associated protein EspG 703 500 coexpression:404 textmining:431
Rv3882c eccE1 ESX-1 secretion system protein EccE1 702 497 ctx cooccurence:475 textmining:433
Rv3883c mycP1 membrane-anchored mycosin 596 474 ctx cooccurence:461
Rv2608 PPE42 PPE family protein PPE42 469 470 ctx cooccurence:469

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspI
  • MTBC0 PGAP product: MinD/ParA family protein
  • Pfam (hmmscan --cut_ga): CbiA PF01656.30 (E=2e-10), AAA_31 PF13614.13 (E=7e-08), ArsA_ATPase PF02374.22 (E=1e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218393.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CbiA (PF01656.30), AAA_31 (PF13614.13), ArsA_ATPase (PF02374.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0455
  • Curated reference: UniProt P9WJC5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor eccD1
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004110|Rv3876|espI
MPIAGPAPTPTESQLAPPRPPTPQTPTGAPQQPESPAPHVPSHGPHQPRRTAPAPPWAKMPIGEPPPAPSRPSASPAEPPTRPAPQHSRRARRGHRYRTDTERNVGKVATGPSIQARLRAEEASGAQLAPGTEPSPAPLGQPRSYLAPPTRPAPTEPPPSPSPQRNSGRRAERRVHPDLAAQHAAAQPDSITAATTGGRRRKRAAPDLDATQKSLRPAAKGPKVKKVKPQKPKATKPPKVVSQRGWRHWVHALTRINLGLSPDEKYELDLHARVRRNPRGSYQIAVVGLKGGAGKTTLTAALGSTLAQVRADRILALDADPGAGNLADRVGRQSGATIADVLAEKELSHYNDIRAHTSVNAVNLEVLPAPEYSSAQRALSDADWHFIADPASRFYNLVLADCGAGFFDPLTRGVLSTVSGVVVVASVSIDGAQQASVALDWLRNNGYQDLASRACVVINHIMPGEPNVAVKDLVRHFEQQVQPGRVVVMPWDRHIAAGTEISLDLLDPIYKRKVLELAAALSDDFERAGRR