Rv1489 Family assigned · medium auto-curated
H37Rv Rv1489 · MTBC0 - ·
118 aa · 1678552–1678908 (+) ·
RefSeq YP_177645.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains DoxX_2 (PF13564.12) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N692
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | DoxX-like family |
| Orthologous group | 2E1QD |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.178 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DoxX_2 | PF13564.12 | 3.7e-11 | 10–106 | DoxX-like family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1490 (membrane protein), medium confidence from genomic context alone (score 438 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1488 hyp |
hypothetical protein | 878 | 879 ctx | neighborhood:828 |
Rv1487 hyp |
hypothetical protein | 853 | 854 ctx | neighborhood:847 |
Rv1486c hyp |
hypothetical protein | 774 | 775 ctx | neighborhood:764 |
Rv1489A hyp |
hypothetical protein | 705 | 705 ctx | neighborhood:691 |
Rv1490 |
membrane protein | 437 | 438 ctx | neighborhood:434 |
Rv2585c |
lipoprotein | 658 | 55 | textmining:653 |
Rv0072 |
glutamine ABC transporter permease | 517 | 54 | textmining:511 |
Rv1078 pra hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv2563 |
glutamine ABC transporter permease | 870 | 41 | textmining:870 |
Rv3623 lpqG |
lipoprotein LpqG | 519 | 41 | textmining:519 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DoxX_2 PF13564.12 (E=4e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177645.1)
- Domains: Pfam-A via hmmscan --cut_ga — DoxX_2 (PF13564.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E1QD - Curated reference: UniProt L7N692 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
Rv1490 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1489| MSGLTSPKTYAVLAALQAGDAVACAIPLPPIARLLDDLDVPVSVRPVLPVVKAASAVGLLSVTRFPALARLTTAMLTLYFILAVGAHVRVRDRVVNAIPAASFLTLFALMTAKGPERT