Rv2867c Family assigned · medium auto-curated

H37Rv Rv2867c · MTBC0 mtbc0_003049 · 284 aa · 3199124–3199978 (-) · RefSeq NP_217383.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotationGNAT family N-acetyltransferase
Revised (this work)GNAT family N-acetyltransferase. Pfam: DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XFI7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameGCN5-related N-acetyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionacetyltransferase
Orthologous groupCOG3393
KEGG orthology K06976

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.962 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4081PF13312.12 1.6e-4054–156 Domain of unknown function (DUF4081)
Acetyltransf_1PF00583.32 4.2e-07201–272 Acetyltransferase (GNAT) family
FR47PF08445.17 4.3e-08215–275 FR47-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gcpE (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)), high confidence from genomic context alone (score 842 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2868c gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 842 842 ctx neighborhood:807
Rv2869c rip zinc metalloprotease 805 804 ctx neighborhood:795
Rv2870c dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase 801 801 ctx neighborhood:795
Rv2115c mpa proteasome-associated ATPase 789 790 coexpression:732
Rv1488 hyp hypothetical protein 748 748 coexpression:740
Rv2239c hyp hypothetical protein 717 718 ctx cooccurence:716
Rv3626c hyp hypothetical protein 701 701 ctx cooccurence:697
Rv3015c hyp hypothetical protein 624 624 ctx cooccurence:624
Rv2864c penicillin-binding lipoprotein 614 614 ctx neighborhood:544
Rv2699c hyp hypothetical protein 572 572 ctx cooccurence:572
Rv3268 hyp hypothetical protein 567 567 ctx cooccurence:555
Rv2256c hyp hypothetical protein 552 552 ctx cooccurence:541
Rv0635 hadA (3R)-hydroxyacyl-ACP dehydratase subunit HadA 528 529 ctx cooccurence:526
Rv0498 hyp hypothetical protein 513 513 ctx cooccurence:510
Rv0037c MFS-type transporter 502 503 ctx cooccurence:498

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GCN5-like N-acetyltransferase
  • MTBC0 PGAP product: GNAT family N-acetyltransferase
  • Pfam (hmmscan --cut_ga): DUF4081 PF13312.12 (E=2e-40), Acetyltransf_1 PF00583.32 (E=4e-07), FR47 PF08445.17 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217383.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3393
  • Curated reference: UniProt I6XFI7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor gcpE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003049|Rv2867c|
MSAPPISRLVGERQVSVVRDAAAVWRVLDDDPIESCMVAARVADHGIDPNAIGGELWTRRGAHESLCFAGANLIPLRGGPIDLNAFADVAMSTPRRCSSLVGRADLVLPMWQRLEPVWGPARDVRDNQPLMALATHPSCAIDTGVRQVRPEELDSYLVAAVDMFIGEVGVDPRLGDGGRGYRRRVAGLIAAGRAWARFEHGQVIFKAEVGSQSPAVGQIQGVWVHPEWRGIGLGTAGTATLAAVIVGSGRIASLYVNSFNTVARAAYARVGFKEIGTFATVLLD