Rv2867c Family assigned · medium auto-curated
H37Rv Rv2867c · MTBC0 mtbc0_003049 ·
284 aa · 3199124–3199978 (-) ·
RefSeq NP_217383.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | GNAT family N-acetyltransferase |
| Revised (this work) | GNAT family N-acetyltransferase. Pfam: DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XFI7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GCN5-related N-acetyltransferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | acetyltransferase |
| Orthologous group | COG3393 |
| KEGG orthology |
K06976
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.962 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4081 | PF13312.12 | 1.6e-40 | 54–156 | Domain of unknown function (DUF4081) |
Acetyltransf_1 | PF00583.32 | 4.2e-07 | 201–272 | Acetyltransferase (GNAT) family |
FR47 | PF08445.17 | 4.3e-08 | 215–275 | FR47-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: gcpE (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)), high confidence from genomic context alone (score 842 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2868c gcpE |
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) | 842 | 842 ctx | neighborhood:807 |
Rv2869c rip |
zinc metalloprotease | 805 | 804 ctx | neighborhood:795 |
Rv2870c dxr |
1-deoxy-D-xylulose 5-phosphate reductoisomerase | 801 | 801 ctx | neighborhood:795 |
Rv2115c mpa |
proteasome-associated ATPase | 789 | 790 | coexpression:732 |
Rv1488 hyp |
hypothetical protein | 748 | 748 | coexpression:740 |
Rv2239c hyp |
hypothetical protein | 717 | 718 ctx | cooccurence:716 |
Rv3626c hyp |
hypothetical protein | 701 | 701 ctx | cooccurence:697 |
Rv3015c hyp |
hypothetical protein | 624 | 624 ctx | cooccurence:624 |
Rv2864c |
penicillin-binding lipoprotein | 614 | 614 ctx | neighborhood:544 |
Rv2699c hyp |
hypothetical protein | 572 | 572 ctx | cooccurence:572 |
Rv3268 hyp |
hypothetical protein | 567 | 567 ctx | cooccurence:555 |
Rv2256c hyp |
hypothetical protein | 552 | 552 ctx | cooccurence:541 |
Rv0635 hadA |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 528 | 529 ctx | cooccurence:526 |
Rv0498 hyp |
hypothetical protein | 513 | 513 ctx | cooccurence:510 |
Rv0037c |
MFS-type transporter | 502 | 503 ctx | cooccurence:498 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: GNAT family N-acetyltransferase
- Pfam (hmmscan --cut_ga): DUF4081 PF13312.12 (E=2e-40), Acetyltransf_1 PF00583.32 (E=4e-07), FR47 PF08445.17 (E=4e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217383.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3393 - Curated reference: UniProt I6XFI7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
gcpE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003049|Rv2867c| MSAPPISRLVGERQVSVVRDAAAVWRVLDDDPIESCMVAARVADHGIDPNAIGGELWTRRGAHESLCFAGANLIPLRGGPIDLNAFADVAMSTPRRCSSLVGRADLVLPMWQRLEPVWGPARDVRDNQPLMALATHPSCAIDTGVRQVRPEELDSYLVAAVDMFIGEVGVDPRLGDGGRGYRRRVAGLIAAGRAWARFEHGQVIFKAEVGSQSPAVGQIQGVWVHPEWRGIGLGTAGTATLAAVIVGSGRIASLYVNSFNTVARAAYARVGFKEIGTFATVLLD