Rv2867c Family assigned · medium auto-curated
H37Rv Rv2867c · MTBC0 mtbc0_003049 ·
284 aa ·
3199124–3199978 MTBC0
(-) ·
RefSeq NP_217383.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | GNAT family N-acetyltransferase |
| Revised (this work) | GNAT family N-acetyltransferase. Pfam: DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (1 in a M. tuberculosis context, 2 in other mycobacteria — M. abscessus (1), M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| An N-acetyltransferase required for EsxA N-terminal protein acetylation and virulence in Mycobacterium marinum. doi:10.1101/2023.03.14.532585 | 2023 |
| Mab_3168c, a putative acetyltransferase, enhances adherence, intracellular survival and antimicrobial resistance of Mycobacterium abscessus. doi:10.1371/journal.pone.0067563 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.01 (95% CI -1.66 to 2.43). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Acetylation, substrate unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2892c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1839
· 87.3% identity |
| M. smegmatis |
MSMEG_2581
· 75.9% identity |
| M. orygis |
RJtmp_002958
· 99.3% identity |
| M. abscessus |
MAB_3168c
· 65.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6XFI7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GCN5-related N-acetyltransferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | acetyltransferase |
| Orthologous group | COG3393 |
| KEGG orthology |
K06976
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.962 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 85.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 54.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 85.9090909091. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +1.84 | 0.031 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.78 | 0.035 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 5.94 ppm · rank 2880/3519 (18.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 284 aa |
|---|---|
| Molecular weight | 30.3 kDa |
| Theoretical pI | 6.97 |
| GRAVY | 0.103 (hydrophobic) |
| Aliphatic index | 95.8 |
| Aromaticity | 0.067 |
| Instability index | 31.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4081 | PF13312.12 | 1.6e-40 | 54–156 | Domain of unknown function (DUF4081) |
Acetyltransf_1 | PF00583.32 | 4.2e-07 | 201–272 | Acetyltransferase (GNAT) family |
FR47 | PF08445.17 | 4.3e-08 | 215–275 | FR47-like protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3iwg-assembly1_A |
1.00 | 0.60 | 1.1e-10 sig | 3iwg-assembly1_A Acetyltransferase from GNAT family from Colwellia psychrerythraea. |
7pk2-assembly2_B |
1.00 | 0.68 | 3.2e-09 sig | 7pk2-assembly2_B Bovine Glycine N-Acyltransferase |
7pk1-assembly1_A |
1.00 | 0.63 | 3.4e-09 sig | 7pk1-assembly1_A Bovine Glycine N-Acyltransferase |
7pk1-assembly2_B |
1.00 | 0.63 | 7.7e-09 sig | 7pk1-assembly2_B Bovine Glycine N-Acyltransferase |
1sqh-assembly1_A |
1.00 | 0.66 | 3.4e-08 sig | 1sqh-assembly1_A X-RAY STRUCTURE OF DROSOPHILA MALONOGASTER PROTEIN Q9VR51 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET FR87. |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | relG (+ strand, 372 bp gap) |
|---|---|
| Downstream (3' on genome) | gcpE (- strand, 55 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: gcpE (4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)), high confidence from genomic context alone (score 842 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2868c gcpE |
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) | 842 | 842 ctx | neighborhood:807 |
Rv2869c rip |
zinc metalloprotease | 805 | 804 ctx | neighborhood:795 |
Rv2870c dxr |
1-deoxy-D-xylulose 5-phosphate reductoisomerase | 801 | 801 ctx | neighborhood:795 |
Rv2115c mpa |
proteasome-associated ATPase | 789 | 790 | coexpression:732 |
Rv1488 hyp |
hypothetical protein | 748 | 748 | coexpression:740 |
Rv2239c hyp |
hypothetical protein | 717 | 718 ctx | cooccurence:716 |
Rv3626c hyp |
hypothetical protein | 701 | 701 ctx | cooccurence:697 |
Rv3015c hyp |
hypothetical protein | 624 | 624 ctx | cooccurence:624 |
Rv2864c |
penicillin-binding lipoprotein | 614 | 614 ctx | neighborhood:544 |
Rv2699c hyp |
hypothetical protein | 572 | 572 ctx | cooccurence:572 |
Rv3268 hyp |
hypothetical protein | 567 | 567 ctx | cooccurence:555 |
Rv2256c hyp |
hypothetical protein | 552 | 552 ctx | cooccurence:541 |
Rv0635 hadA |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 528 | 529 ctx | cooccurence:526 |
Rv0498 hyp |
hypothetical protein | 513 | 513 ctx | cooccurence:510 |
Rv0037c |
MFS-type transporter | 502 | 503 ctx | cooccurence:498 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: GNAT family N-acetyltransferase
- Pfam (hmmscan --cut_ga): DUF4081 PF13312.12 (E=2e-40), Acetyltransf_1 PF00583.32 (E=4e-07), FR47 PF08445.17 (E=4e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217383.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4081 (PF13312.12), Acetyltransf_1 (PF00583.32), FR47 (PF08445.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3393 - Curated reference: UniProt I6XFI7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
gcpE - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003049|Rv2867c| MSAPPISRLVGERQVSVVRDAAAVWRVLDDDPIESCMVAARVADHGIDPNAIGGELWTRRGAHESLCFAGANLIPLRGGPIDLNAFADVAMSTPRRCSSLVGRADLVLPMWQRLEPVWGPARDVRDNQPLMALATHPSCAIDTGVRQVRPEELDSYLVAAVDMFIGEVGVDPRLGDGGRGYRRRVAGLIAAGRAWARFEHGQVIFKAEVGSQSPAVGQIQGVWVHPEWRGIGLGTAGTATLAAVIVGSGRIASLYVNSFNTVARAAYARVGFKEIGTFATVLLD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2867c? Email the maintainer — the message is pre-filled with this gene's details.