Rv1489A Family assigned · medium auto-curated

H37Rv Rv1489A · MTBC0 - · 76 aa · 1678942–1679172 (+) · RefSeq YP_177646.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains MM_CoA_mutase (PF01642.29) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6A8 TrEMBL · unreviewed · Predicted
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namemutA
eggNOG descriptioncobalamin binding
Orthologous groupCOG2185
EC number EC 5.4.99.2
KEGG orthology K01847
KEGG pathways map00280, map00630, map00640, map00720, map01100, map01120, map01200
KEGG modules M00373, M00376, M00741

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.39% of strains (569) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MM_CoA_mutasePF01642.29 9.2e-065–55 Methylmalonyl-CoA mutase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0513 (transmembrane protein), high confidence from genomic context alone (score 705 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1492 mutA methylmalonyl-CoA mutase small subunit 998 999 coexpression:688 experimental:994
Rv1493 mutB methylmalonyl-CoA mutase large subunit 875 863 experimental:782
Rv1496 meaB transport system kinase 751 727 coexpression:690
Rv1489 hyp hypothetical protein 705 705 ctx neighborhood:691
Rv0513 transmembrane protein 704 705 ctx cooccurence:704
Rv3802c membrane protein 703 704 ctx cooccurence:691
Rv1488 hyp hypothetical protein 667 667 ctx neighborhood:663
Rv1487 hyp hypothetical protein 665 665 ctx neighborhood:608
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 657 657 ctx cooccurence:657
Rv3346c transmembrane protein 615 615 ctx cooccurence:615
Rv0227c membrane protein 613 613 ctx cooccurence:613
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 599 600 ctx cooccurence:596
Rv3668c protease 585 586 ctx cooccurence:583
Rv0226c transmembrane protein 580 580 ctx cooccurence:579
Rv2876 transmembrane protein 580 580 ctx cooccurence:579

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): MM_CoA_mutase PF01642.29 (E=9e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177646.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MM_CoA_mutase (PF01642.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2185
  • Curated reference: UniProt L7N6A8 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor Rv0513
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1489A|
MSVGEVEVLKVENSRVRAEQLAKLYELRSSRDRVRVDAALAELSRAAAARGCAGTSGLGNNLMAPGPPHSLLGRDR