mazF4 Resolved · high auto-curated

H37Rv Rv1495 · MTBC0 mtbc0_001599 · 105 aa · 1696375–1696692 (+) · RefSeq NP_216011.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mRNA interferase MazF4
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin endoribonuclease MazF4
Revised (this work)Type II toxin-antitoxin system toxin endoribonuclease MazF4. Pfam: PemK_toxin (PF02452.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WII5 SwissProt · reviewed · Evidence at protein level
UniProt nameEndoribonuclease MazF4
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Acts as an endoribonuclease (mRNA interferase) on single-strand mRNA, cleaving between the first and second bases in the sequence UCGCU. Overexpression in M.smegmatis but not E.coli inhibits growth, this effect is neutralized by coexpression with cognate toxin MazE4..; FUNCTION: Residues 29-56 inhibit ssDNA cleavage by DNA topoisomerase. This fragment does not have mRNA cleavage activity but it inhibits growth upon overexpression in M.smegmatis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionPemK-like, MazF-like toxin of type II toxin-antitoxin system
Orthologous groupCOG2337
KEGG orthology K07171
Gene Ontology (13) GO:0008150, GO:0010911, GO:0032780, GO:0043086, GO:0043462, GO:0044092, GO:0050790, GO:0051336, GO:0051346, GO:0065007, GO:0065009, GO:2000371 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PemK_toxinPF02452.24 2.6e-146–99 PemK-like, MazF-like toxin of type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazE4 (antitoxin MazE4), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1494 mazE4 antitoxin MazE4 999 1000 ctx neighborhood:882 experimental:999 textmining:594
Rv1496 meaB transport system kinase 803 802 ctx neighborhood:801
Rv1493 mutB methylmalonyl-CoA mutase large subunit 827 773 ctx neighborhood:772
Rv1492 mutA methylmalonyl-CoA mutase small subunit 773 773 ctx neighborhood:772
Rv3387 transposase 629 630 ctx cooccurence:628
Rv1497 lipL esterase LipL 625 625 ctx neighborhood:619
Rv1991A mazE6 antitoxin MazE6 638 607 experimental:434
Rv2961 transposase 575 575 ctx cooccurence:575
Rv1034c Probable transposase (fragment); Rv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E12023 562 562 ctx cooccurence:562
Rv1491c TVP38/TMEM64 family membrane protein 500 501 ctx neighborhood:499
Rv3386 transposase 490 491 ctx cooccurence:488
Rv0960 vapC9 ribonuclease VapC9 472 453 ctx cooccurence:452
Rv0065 vapC1 ribonuclease VapC1 504 452 ctx cooccurence:451
Rv1149 transposase 437 437 ctx cooccurence:436
Rv1042c IS2-like transposase 437 437 ctx cooccurence:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mRNA interferase MazF4
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin endoribonuclease MazF4
  • Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=3e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216011.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2337
  • Curated reference: UniProt P9WII5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor mazE4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001599|Rv1495|mazF4
MNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDYLGEVTPATMNKINTALATALGLPWP