Rv1417 Family assigned · medium auto-curated

H37Rv Rv1417 · MTBC0 mtbc0_001517 · 154 aa · 1601494–1601958 (+) · RefSeq NP_215933.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationPH domain-containing protein
Revised (this work)PH domain-containing protein. Pfam: bPH_6 (PF10756.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLY1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1417

UniProt still lists this protein as Uncharacterized protein Rv1417; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial PH domain
Orthologous group2E71H
Gene Ontology (34) GO:0005575, GO:0005623, GO:0005886, GO:0006766, GO:0006767, GO:0006771, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009110, GO:0009231 +22 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_6PF10756.16 1.0e-2572–141 Bacterial PH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ribA2 (bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase), high confidence from genomic context alone (score 902 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 902 902 ctx neighborhood:881
Rv1416 ribH 6,7-dimethyl-8-ribityllumazine synthase 976 885 ctx neighborhood:881 textmining:803
Rv1418 lprH lipoprotein LprH 849 850 ctx neighborhood:846
Rv1388 mihF integration host factor MihF 825 825 experimental:436 database:540
Rv0705 rpsS 30S ribosomal protein S19 817 818 experimental:463 database:574
Rv0682 rpsL 30S ribosomal protein S12 814 806 experimental:463 database:573
Rv0710 rpsQ 30S ribosomal protein S17 804 798 experimental:463 database:578
Rv0707 rpsC 30S ribosomal protein S3 803 796 experimental:463 database:578
Rv0721 rpsE 30S ribosomal protein S5 799 792 experimental:463 database:575
Rv2056c rpsN2 30S ribosomal protein S14 788 788 experimental:436 database:548
Rv0717 rpsN1 30S ribosomal protein S14 787 788 experimental:436 database:548
Rv0718 rpsH 30S ribosomal protein S8 794 787 experimental:463 database:578
Rv0700 rpsJ 30S ribosomal protein S10 789 785 experimental:463 database:557
Rv2785c rpsO 30S ribosomal protein S15 784 782 experimental:463 database:573
Rv0702 rplD 50S ribosomal protein L4 788 781 experimental:463 database:575

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: PH domain-containing protein
  • Pfam (hmmscan --cut_ga): bPH_6 PF10756.16 (E=1e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215933.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_6 (PF10756.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E71H
  • Curated reference: UniProt P9WLY1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 135 functional partner(s); context anchor ribA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001517|Rv1417|
MTAAPNDWDVVLRPHWTPLFAYAAAFLIAVAHVAGGLLLKVGSSGVVFQTADQVAMGALGLVLAGAVLLFARPRLRVGSAGLSVRNLLGDRIVGWSEVIGVSFPGGSRWARIDLADDEYIPVMAIQAVDKDRAVAAMDTVRSLLARYRPDLCAR