rpe Resolved · high auto-curated

H37Rv Rv1408 · MTBC0 mtbc0_001509 · 232 aa · 1593843–1594541 (+) · RefSeq NP_215924.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribulose-phosphate 3-epimerase
MTBC0 PGAP re-annotationribulose-phosphate 3-epimerase
Revised (this work)Ribulose-phosphate 3-epimerase. Pfam: Ribul_P_3_epim (PF00834.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WI51 SwissProt · reviewed · Evidence at protein level
UniProt nameRibulose-phosphate 3-epimerase
EC (curated) EC 5.1.3.1
Curated functionCatalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namerpe
eggNOG descriptionBelongs to the ribulose-phosphate 3-epimerase family
Orthologous groupCOG0036
EC number EC 5.1.3.1
KEGG orthology K01783
KEGG pathways map00030, map00040, map00710, map01100, map01110, map01120, map01130, map01200, map01230
KEGG modules M00004, M00007
Gene Ontology (62) GO:0003674, GO:0003824, GO:0004750, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005975, GO:0005996, GO:0006081 +50 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.35 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 3.44% of strains (5001) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribul_P_3_epimPF00834.26 2.6e-8313–207 Ribulose-phosphate 3 epimerase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fmu (16S rRNA m5C967 methyltransferase), high confidence from genomic context alone (score 892 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1449c tkt transketolase 991 973 coexpression:408 database:900 textmining:719
Rv1844c gnd1 6-phosphogluconate dehydrogenase 951 928 database:900
Rv2465c rpiB ribose-5-phosphate isomerase B 941 924 database:900
Rv0729 xylB D-xylulose kinase XylB 938 920 database:900
Rv1122 gnd2 6-phosphogluconate dehydrogenase (decarboxylating) 909 902 database:900
Rv1407 fmu 16S rRNA m5C967 methyltransferase 896 892 ctx neighborhood:846
Rv1406 fmt methionyl-tRNA formyltransferase 898 888 ctx neighborhood:846
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 896 887 ctx neighborhood:881
Rv1437 pgk phosphoglycerate kinase 925 798 ctx cooccurence:676 textmining:649
Rv1392 metK S-adenosylmethionine synthetase 797 776 ctx cooccurence:683
Rv2555c alaS alanine--tRNA ligase 697 698 ctx cooccurence:501 coexpression:400
Rv1389 gmk guanylate kinase 723 683 ctx cooccurence:540
Rv1438 tpi triosephosphate isomerase 876 664 ctx cooccurence:564 textmining:648
Rv1405c methyltransferase 612 612 ctx neighborhood:602
Rv1017c prsA ribose-phosphate pyrophosphokinase 821 606 coexpression:411 textmining:566

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribulose-phosphate 3-epimerase
  • MTBC0 PGAP product: ribulose-phosphate 3-epimerase
  • Pfam (hmmscan --cut_ga): Ribul_P_3_epim PF00834.26 (E=3e-83)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215924.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribul_P_3_epim (PF00834.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0036
  • Curated reference: UniProt P9WI51 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor fmu
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001509|Rv1408|rpe
MSLMAGSTGGPLIAPSILAADFARLADEAAAVNGADWLHVDVMDGHFVPNLTIGLPVVESLLAVTDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGISVKPGTPLEPYLDILPHFDTLLVMSVEPGFGGQRFIPEVLSKVRAVRKMVDAGELTILVEIDGGINDDTIEQAAEAGVDCFVAGSAVYGADDPAAAVAALRRQAGAASLHLSL