ribH Resolved · high auto-curated

H37Rv Rv1416 · MTBC0 mtbc0_001516 · 160 aa · 1601015–1601497 (+) · RefSeq NP_215932.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)6,7-dimethyl-8-ribityllumazine synthase
MTBC0 PGAP re-annotation6%2C7-dimethyl-8-ribityllumazine synthase
Revised (this work)6%2C7-dimethyl-8-ribityllumazine synthase. Pfam: DMRL_synthase (PF00885.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHE9 SwissProt · reviewed · Evidence at protein level
UniProt name6,7-dimethyl-8-ribityllumazine synthase
EC (curated) EC 2.5.1.78
Curated functionCatalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred nameribH
eggNOG descriptionCatalyzes the formation of 6,7-dimethyl-8- ribityllumazine by condensation of 5-amino-6-(D- ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin
Orthologous groupCOG0054
EC number EC 2.5.1.78
KEGG orthology K00794
KEGG pathways map00740, map01100, map01110
KEGG modules M00125
Gene Ontology (42) GO:0000906, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006766, GO:0006767, GO:0006771, GO:0006807 +30 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.385 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DMRL_synthasePF00885.25 9.1e-4918–152 6,7-dimethyl-8-ribityllumazine synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ribA1 (riboflavin biosynthesis protein RibA), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1940 ribA1 riboflavin biosynthesis protein RibA 999 1000 ctx cooccurence:774 coexpression:985 database:900 textmining:418
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 999 1000 ctx neighborhood:881 cooccurence:774 coexpression:986 database:900 textmining:885
Rv1412 ribC riboflavin synthase 999 999 ctx neighborhood:675 cooccurence:774 coexpression:853 database:900 textmining:638
Rv1392 metK S-adenosylmethionine synthetase 991 991 coexpression:987
Rv0985c mscL large-conductance ion mechanosensitive channel 988 987 coexpression:987
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 995 978 ctx cooccurence:772 coexpression:824 textmining:796
Rv1380 pyrB aspartate carbamoyltransferase 948 948 coexpression:945
Rv1417 membrane protein 976 885 ctx neighborhood:881 textmining:803
Rv2786c ribF bifunctional riboflavin kinase /FMN adenylyltransferase 974 883 coexpression:762 database:500 textmining:787
Rv1418 lprH lipoprotein LprH 850 851 ctx neighborhood:846
Rv1407 fmu 16S rRNA m5C967 methyltransferase 815 741 coexpression:660
Rv2442c rplU 50S ribosomal protein L21 733 733 coexpression:733
Rv3443c rplM 50S ribosomal protein L13 699 700 coexpression:698
Rv1422 cuvA hyp hypothetical protein 691 692 ctx neighborhood:682
Rv1421 rapZ hyp hypothetical protein 689 689 ctx neighborhood:682

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 6,7-dimethyl-8-ribityllumazine synthase
  • MTBC0 PGAP product: 6%2C7-dimethyl-8-ribityllumazine synthase
  • Pfam (hmmscan --cut_ga): DMRL_synthase PF00885.25 (E=9e-49)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215932.2)
  • Domains: Pfam-A via hmmscan --cut_ga — DMRL_synthase (PF00885.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0054
  • Curated reference: UniProt P9WHE9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s); context anchor ribA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001516|Rv1416|ribH
MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS