lipO Family assigned · medium auto-curated

H37Rv Rv1426c · MTBC0 mtbc0_001526 · 420 aa · 1610403–1611665 MTBC0 (-) · RefSeq NP_215942.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand ribA2 (Rv1415) — requalified: bifunctional 3%2C4-dihydroxy-2-butanone-4-phosphate synthase ribA2 ribH (Rv1416) — requalified: 6%2C7-dimethyl-8-ribityllumazine synthase Rv1417 (Rv1417) — family_assigned: PH domain-containing protein lprH (Rv1418) — family_assigned: hypothetical protein Rv1419 (Rv1419) — requalified: lectin uvrC (Rv1420) — family_assigned: excinuclease ABC subunit UvrC uvrC rapZ (Rv1421) — requalified: RNase adapter RapZ rapZ cuvA (Rv1422) — requalified: carbon utilization/virulence protein CuvA cuvA whiA (Rv1423) — family_assigned: DNA-binding protein WhiA whiA Rv1424c (Rv1424c) — dark: hypothetical protein Rv1425 (Rv1425) — family_assigned: wax ester/triacylglycerol synthase family O-acyltransferase Rv1425 lipO (Rv1426c) — family_assigned: alpha/beta hydrolase lipO fadD12 (Rv1427c) — requalified: acyl-CoA ligase FadD12 fadD12 Rv1428c (Rv1428c) — family_assigned: lysophospholipid acyltransferase family protein Rv1428c Rv1429 (Rv1429) — family_assigned: PucR family transcriptional regulator Rv1429 Rv1431 (Rv1431) — family_assigned: DUF3556 domain-containing protein Rv1431 Rv1432 (Rv1432) — requalified: NAD(P)/FAD-dependent oxidoreductase Rv1432 ldtMt3 (Rv1433) — requalified: L%2CD-transpeptidase LdtMt3 Rv1434 (Rv1434) — dark: hypothetical protein hsr1 (Rv1435c) — requalified: hypothetical protein gap (Rv1436) — requalified: type I glyceraldehyde-3-phosphate dehydrogenase 1 600 kb 1 604 kb 1 608 kb 1 612 kb 1 616 kb 1 620 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase LipO
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: COesterase (PF00135.35), BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20), Peptidase_S9 (PF00326.28).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 50 publications

50 TB publications mention this gene. 50 publication(s) discuss this gene (27 in a M. tuberculosis context, 12 in other mycobacteria — M. smegmatis (5), M. abscessus (4), M. leprae (2), M. marinum (2)).

Most recent 5 of 50.
PublicationDate
Essential role of MptB in the biosynthesis of phosphatidylinositol mannosides, lipomannan and lipoarabinomannan in mycobacteria. doi:10.1016/j.jbc.2026.113077 2026
Novel C5α-substituted carbapenems enhance Mycobacterium abscessus killing via selective target binding and reduced hydrolysis by BlaMab. doi:10.1128/aac.00170-25 2025
Durlobactam in combination with β-lactams to combat Mycobacterium abscessus. doi:10.1128/aac.01174-24 2025
Role of succinyl substituents in the mannose-capping of lipoarabinomannan and control of inflammation in Mycobacterium tuberculosis infection. doi:10.1371/journal.ppat.1011636 2023
Taeanamides A and B, Nonribosomal Lipo-Decapeptides Isolated from an Intertidal-Mudflat-Derived Streptomyces sp. doi:10.3390/md20060400 2022

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourfadD12 (Rv1427c, - strand)
Overlap1 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.50 (95% CI -0.55 to 5.07). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown, but supposedly involved in lipid metabolism
Mycobrowser EC 3.1.-.-

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1461c · 100.0% identity
M. marinum MMAR_2232 · 81.2% identity
M. smegmatis MSMEG_0302 · 59.5% identity
M. orygis RJtmp_001505 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O06832 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable esterase LipO

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namelipO
eggNOG descriptionesterase
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.271 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 74.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 1/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 49.1%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 29 in the ORF — 0 in the essential state, 0 growth-defect, 29 non-essential, 0 growth-advantage. Saturation 0.897, mean read count 29.6153846154. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.030.0083 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance23.4 ppm · rank 2235/3519 (36.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (2 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)2

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length420 aa
Molecular weight46.1 kDa
Theoretical pI10.09
GRAVY-0.113 (hydrophilic)
Aliphatic index85.5
Aromaticity0.1
Instability index44.0 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
COesterasePF00135.35 1.2e-13174–273 Carboxylesterase family
BD-FAEPF20434.6 1.4e-40175–370 BD-FAE
Abhydrolase_3PF07859.20 1.4e-18182–390 alpha/beta hydrolase fold
Peptidase_S9PF00326.28 3.1e-12205–412 Prolyl oligopeptidase family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.7

PDB hitprobTM-scoreE-valueDescription
6xyc-assembly1_A 1.00 0.76 1.8e-14 sig 6xyc-assembly1_A Truncated form of carbohydrate esterase from gut microbiota
6mly-assembly1_A 1.00 0.79 6.9e-13 sig 6mly-assembly1_A Bifunctional GH43-CE Bacteroides eggerthii, BACEGG_01304
6nkf-assembly2_B 1.00 0.70 1.2e-13 sig 6nkf-assembly2_B Crystal Structure of the Lipase Lip_vut4 from Goat Rumen metagenome.
6mly-assembly3_C 1.00 0.78 1.9e-12 sig 6mly-assembly3_C Bifunctional GH43-CE Bacteroides eggerthii, BACEGG_01304
2yh2-assembly1_D 1.00 0.73 4.5e-12 sig 2yh2-assembly1_D Pyrobaculum calidifontis esterase monoclinic form

Foldseek search of the AlphaFold DB model (mean pLDDT 91.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv1425 (+ strand, 21 bp gap)
Downstream (3' on genome)fadD12 (- strand, -1 bp gap)
Predicted operon lipO · fadD12 · Rv1428c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: fadD12 (acyl-CoA synthetase), high confidence from genomic context alone (score 986 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1427c fadD12 acyl-CoA synthetase 996 986 ctx neighborhood:882 coexpression:866 textmining:755
Rv1428c hyp hypothetical protein 928 927 ctx neighborhood:882 coexpression:409
Rv1429 hyp hypothetical protein 589 590 ctx neighborhood:587
Rv0310c hyp exp hypothetical protein 580 578 experimental:439
Rv0722 rpmD exp 50S ribosomal protein L30 495 496 database:490
Rv2903c lepB exp signal peptidase 504 485 database:464
Rv3153 nuoI exp NADH-quinone oxidoreductase subunit I 465 466 experimental:440
Rv3151 nuoG exp NADH-quinone oxidoreductase subunit G 485 463 experimental:441
Rv3149 nuoE exp NADH-quinone oxidoreductase subunit E 456 457 experimental:440
Rv3150 nuoF exp NADH-quinone oxidoreductase subunit F 456 456 experimental:441
Rv2195 qcrA exp ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 435 436 experimental:426
Rv2946c pks1 polyketide synthase 473 421
Rv2782c pepR exp zinc protease 444 419 experimental:413
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 436 416
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 411 411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase LipO
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): COesterase PF00135.35 (E=1e-13), BD-FAE PF20434.6 (E=1e-40), Abhydrolase_3 PF07859.20 (E=1e-18), Peptidase_S9 PF00326.28 (E=3e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215942.1)
  • Domains: Pfam-A via hmmscan --cut_ga — COesterase (PF00135.35), BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20), Peptidase_S9 (PF00326.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt O06832 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor fadD12
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001526|Rv1426c|lipO
MRFRRMARPRPLTRAAVELLNAANGLRPLSGSGYSTVLAFWLGWPTSEVPGVYLGASVLDALRRGRRGDFGGLKGKAALALTAAAWVILAVIRYRGATTPGPVLEAGLTEQLGPDYAKELATLPTEPMRSRGRNLPLRTAMARRRYVETTNVVCYGPYGRANLADIWRRRDLPRDAKAPVLVQVPGGAWVLGWRRPQAYPLMSHLAARGWVCVSLNYRVSPRHTWPDHIVDVKRALAWVKENIAAYGGDPNFVAISGGSAGGHLCALAALTPNDPRFQPGFEQVDTSVAAAVPVYGRYDWFTTDAPGRREFVGLLETFVVKRKFSTHRDIFVDASPIHHVRADAPPFFVLHGRHDSLIPVAEAHAFVEELRAVSKSPVAYADLPHAQHAFDVFGSPRAHHTAEAVARFLSWVYATNPPAT