lipO Family assigned · medium auto-curated

H37Rv Rv1426c · MTBC0 mtbc0_001526 · 420 aa · 1610403–1611665 (-) · RefSeq NP_215942.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase LipO
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: COesterase (PF00135.35), BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20), Peptidase_S9 (PF00326.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06832 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable esterase LipO

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namelipO
eggNOG descriptionesterase
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.271 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
COesterasePF00135.35 1.2e-13174–273 Carboxylesterase family
BD-FAEPF20434.6 1.4e-40175–370 BD-FAE
Abhydrolase_3PF07859.20 1.4e-18182–390 alpha/beta hydrolase fold
Peptidase_S9PF00326.28 3.1e-12205–412 Prolyl oligopeptidase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD12 (acyl-CoA synthetase), high confidence from genomic context alone (score 986 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1427c fadD12 acyl-CoA synthetase 996 986 ctx neighborhood:882 coexpression:866 textmining:755
Rv1428c hyp hypothetical protein 928 927 ctx neighborhood:882 coexpression:409
Rv1429 hyp hypothetical protein 589 590 ctx neighborhood:587
Rv0310c hyp hypothetical protein 580 578 experimental:439
Rv0722 rpmD 50S ribosomal protein L30 495 496 database:490
Rv2903c lepB signal peptidase 504 485 database:464
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 465 466 experimental:440
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 485 463 experimental:441
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 456 457 experimental:440
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 456 456 experimental:441
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 435 436 experimental:426
Rv2946c pks1 polyketide synthase 473 421
Rv2782c pepR zinc protease 444 419 experimental:413
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 436 416
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 411 411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase LipO
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): COesterase PF00135.35 (E=1e-13), BD-FAE PF20434.6 (E=1e-40), Abhydrolase_3 PF07859.20 (E=1e-18), Peptidase_S9 PF00326.28 (E=3e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215942.1)
  • Domains: Pfam-A via hmmscan --cut_ga — COesterase (PF00135.35), BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20), Peptidase_S9 (PF00326.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt O06832 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor fadD12
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001526|Rv1426c|lipO
MRFRRMARPRPLTRAAVELLNAANGLRPLSGSGYSTVLAFWLGWPTSEVPGVYLGASVLDALRRGRRGDFGGLKGKAALALTAAAWVILAVIRYRGATTPGPVLEAGLTEQLGPDYAKELATLPTEPMRSRGRNLPLRTAMARRRYVETTNVVCYGPYGRANLADIWRRRDLPRDAKAPVLVQVPGGAWVLGWRRPQAYPLMSHLAARGWVCVSLNYRVSPRHTWPDHIVDVKRALAWVKENIAAYGGDPNFVAISGGSAGGHLCALAALTPNDPRFQPGFEQVDTSVAAAVPVYGRYDWFTTDAPGRREFVGLLETFVVKRKFSTHRDIFVDASPIHHVRADAPPFFVLHGRHDSLIPVAEAHAFVEELRAVSKSPVAYADLPHAQHAFDVFGSPRAHHTAEAVARFLSWVYATNPPAT