Rv1419 Resolved · high auto-curated

H37Rv Rv1419 · MTBC0 mtbc0_001519 · 157 aa · 1602849–1603322 (+) · RefSeq NP_215935.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationlectin
Revised (this work)Lectin. Pfam: Ricin_B_lectin (PF00652.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLX9 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1419

UniProt still lists this protein as Uncharacterized protein Rv1419; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionRicin-type beta-trefoil
Orthologous group2AUAB
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.783 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.95% of strains (1375) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ricin_B_lectinPF00652.29 7.3e-1937–153 Ricin-type beta-trefoil lectin domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uvrC (excinuclease ABC subunit UvrC), medium confidence from genomic context alone (score 616 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1420 uvrC excinuclease ABC subunit UvrC 615 616 ctx neighborhood:607
Rv1421 rapZ hyp hypothetical protein 607 608 ctx neighborhood:607
Rv1423 whiA transcriptional regulator WhiA 597 598 ctx neighborhood:594
Rv1422 cuvA hyp hypothetical protein 596 597 ctx neighborhood:594
Rv1418 lprH lipoprotein LprH 486 487 ctx neighborhood:485
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 446 446 ctx neighborhood:417
Rv1417 membrane protein 432 432 ctx neighborhood:417
Rv1416 ribH 6,7-dimethyl-8-ribityllumazine synthase 423 423 ctx neighborhood:417
Rv1251c hyp hypothetical protein 422 423 coexpression:423
Rv0440 groEL2 molecular chaperone GroEL 439 391
Rv3417c groEL1 chaperonin GroEL 412 390
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 560 353
Rv1677 dsbF lipoprotein DsbF 412 106
Rv1859 modC molybdenum ABC transporter ATP-binding protein ModC 804 50 textmining:803
Rv1252c lprE lipoprotein LprE 406 50 textmining:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: lectin
  • Pfam (hmmscan --cut_ga): Ricin_B_lectin PF00652.29 (E=7e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215935.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ricin_B_lectin (PF00652.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AUAB
  • Curated reference: UniProt P9WLX9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor uvrC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001519|Rv1419|
MGELRLVGGVLRVLVVVGAVFDVAVLNAGAASADGPVQLKSRLGDVCLDAPSGSWFSPLVINPCNGTDFQRWNLTDDRQVESVAFPGECVNIGNALWARLQPCVNWISQHWTVQPDGLVKSDLDACLTVLGGPDPGTWVSTRWCDPNAPDQQWDSVP