Rv1428c Family assigned · medium auto-curated

H37Rv Rv1428c · MTBC0 mtbc0_001528 · 275 aa · 1613276–1614103 (-) · RefSeq NP_215944.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationlysophospholipid acyltransferase family protein
Revised (this work)Lysophospholipid acyltransferase family protein. Pfam: Acyltransferase (PF01553.27), DAGAT (PF03982.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06830 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhospholipid/glycerol acyltransferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionAcyltransferase
Orthologous groupCOG0204

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.674 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AcyltransferasePF01553.27 1.9e-1943–171 Acyltransferase
DAGATPF03982.19 9.3e-1049–265 Diacylglycerol acyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD12 (acyl-CoA synthetase), high confidence from genomic context alone (score 949 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1427c fadD12 acyl-CoA synthetase 949 949 ctx neighborhood:882 coexpression:533
Rv1426c lipO esterase LipO 928 927 ctx neighborhood:882 coexpression:409
Rv1429 hyp hypothetical protein 654 654 ctx neighborhood:587
Rv0501 galE2 UDP-glucose 4-epimerase GalE 601 587 ctx cooccurence:573
Rv0222 echA1 enoyl-CoA hydratase EchA1 578 572 ctx neighborhood:516
Rv1431 hyp hypothetical protein 527 527
Rv3680 anion transporter ATPase 514 515 ctx cooccurence:508
Rv2139 pyrD dihydroorotate dehydrogenase 499 499 coexpression:418
Rv0425c ctpH metal cation transporting ATPase H 467 466 database:451
Rv0908 ctpE metal cation transporter ATPase E 466 466 database:451
Rv0107c ctpI cation-transporter ATPase I 465 465 database:451
Rv3167c TetR family transcriptional regulator 464 464 ctx cooccurence:463
Rv1997 ctpF cation transporter ATPase F 464 464 database:451
Rv1305 atpE ATP synthase subunit C 450 450 database:434
Rv3679 anion transporter ATPase 446 446 ctx cooccurence:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: lysophospholipid acyltransferase family protein
  • Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=2e-19), DAGAT PF03982.19 (E=9e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215944.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27), DAGAT (PF03982.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt O06830 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor fadD12
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001528|Rv1428c|
MSETDSPGNGDDAGIGDIGKFDPGLTQRLISVLRPVLKTYHRSQVHGLDSFPPGGALVVANHSGGMFPMDVPVFSVDFYDKFGYDRPVYTLSHDILFMGLTGDLFRRTGYIRATRENAAKALRSGGVVVVFPGGDYDAYRPTFAENVIDFNGRKGYVSTAVEAGVPIVPAVSIGGQESQLYLSRGTWLARRLGLKRLLRSDILPISFGFPFGFSAAIPPNLPLPAKIVMQVLDPINLTKQFGEDPDVDAVDEHVRSVMQQALNDLAAKRRFPILG