Rv1360 Resolved · high auto-curated

H37Rv Rv1360 · MTBC0 mtbc0_001462 · 340 aa · 1542050–1543072 (+) · RefSeq NP_215876.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationLLM class F420-dependent oxidoreductase
Revised (this work)LLM class F420-dependent oxidoreductase. Pfam: Bac_luciferase (PF00296.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM03 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1360

UniProt still lists this protein as Uncharacterized protein Rv1360; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionF420-dependent oxidoreductase
Orthologous groupCOG2141

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.619 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (370) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_luciferasePF00296.27 6.9e-6515–316 Luciferase-like monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ddn (deazaflavin-dependent nitroreductase), medium confidence from genomic context alone (score 692 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3547 ddn deazaflavin-dependent nitroreductase 710 692 ctx cooccurence:692
Rv3093c oxidoreductase 662 662 ctx cooccurence:660
Rv3262 fbiB coenzyme F420:L-glutamate ligase 667 635 ctx cooccurence:587
Rv2893 oxidoreductase 631 631 ctx cooccurence:631
Rv3261 fbiA 2-phospho-L-lactate transferase 639 619 ctx cooccurence:604
Rv3178 nitroreductase 624 601 ctx cooccurence:599
Rv1261c hyp hypothetical protein 583 583 ctx cooccurence:577
Rv1855c oxidoreductase 579 579 ctx cooccurence:577
Rv3072c hyp hypothetical protein 599 552 ctx cooccurence:550
Rv1558 hyp hypothetical protein 631 550 ctx cooccurence:548
Rv2161c hyp hypothetical protein 538 539 ctx cooccurence:536
Rv0940c oxidoreductase 541 487 ctx cooccurence:484
Rv2983 cofC 2-phospho-L-lactate guanylyltransferase 486 432 ctx cooccurence:410
Rv3079c hyp hypothetical protein 430 430 ctx cooccurence:430
Rv1628c hyp hypothetical protein 417 417 ctx cooccurence:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: LLM class F420-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=7e-65)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215876.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2141
  • Curated reference: UniProt P9WM03 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor ddn
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001462|Rv1360|
MGGARRLKLDGSIPNQLARAADAAVALERNGFDGGWTAEASHDPFLPLLLAAEHTSRLELGTNIAVAFARNPMIVANVGWDLQTYSKGRLILGLGTQIRPHIEKRFSMPWGHPARRMREFVAALRAIWLAWQDGTKLCFEGEFYTHKIMTPMFTPEPQPYPVPRVFIAAVGEAMTEMCGEVADGHLGHPMVSKRYLTEVSVPALLRGLARSGRDRSAFEVSCEVMVATGADDAELAAACTATRKQIAFYGSTPAYRKVLEQHGWGDLHPELHRLSKLGEWEAMGGLIDDEMLGAFAVVGPVDTIAGALRNRCEGVVDRVLPIFMAASQECINAALQDFRR