Rv1556 Family assigned · medium auto-curated

H37Rv Rv1556 · MTBC0 mtbc0_001663 · 202 aa · 1770808–1771416 (+) · RefSeq NP_216072.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator
MTBC0 PGAP re-annotationTetR/AcrR family transcriptional regulator
Revised (this work)TetR/AcrR family transcriptional regulator. Pfam: TetR_N (PF00440.30), TetR_C_11 (PF16859.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMD1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized HTH-type transcriptional regulator Rv1556

UniProt still lists this protein as Uncharacterized HTH-type transcriptional regulator Rv1556; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309
Gene Ontology (41) GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 1.9e-1525–71 Bacterial regulatory proteins, tetR family
TetR_C_11PF16859.11 1.1e-2482–192 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3167c TetR family transcriptional regulator 861 862 coexpression:810
Rv3830c TetR family transcriptional regulator 863 859 coexpression:802
Rv0452 transcriptional regulator 854 854 coexpression:788
Rv1151c cobB NAD-dependent protein deacylase 846 841 coexpression:841
Rv1167c transcriptional regulator 841 841 coexpression:785
Rv1931c transcriptional regulator 833 834 coexpression:803
Rv1189 sigI ECF RNA polymerase sigma factor SigI 828 829 coexpression:797
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 831 826 coexpression:803
Rv1267c embR transcriptional regulator EmbR 829 826 coexpression:826
Rv2282c LysR family HTH-type transcriptional regulator 830 825 coexpression:803
Rv0117 oxyS oxidative stress response regulatory protein OxyS 822 816 coexpression:793
Rv1725c hyp hypothetical protein 817 813 coexpression:813
Rv3736 AraC/XylS family transcriptional regulator 809 806 coexpression:806
Rv0212c nadR transcriptional regulator NadR 813 805 coexpression:805
Rv1027c kdpE transcriptional regulator KdpE 805 804 coexpression:804

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator
  • MTBC0 PGAP product: TetR/AcrR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=2e-15), TetR_C_11 PF16859.11 (E=1e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216072.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_11 (PF16859.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt P9WMD1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 68 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001663|Rv1556|
MVGAVTQIADRPTDPSPWSPRETELLAVTLRLLQEHGYDRLTVDAVAASARASKATVYRRWPSKAELVLAAFIEGIRQVAVPPNTGNLRDDLLRLGELICREVGQHASTIRAVLVEVSRNPALNDVLQHQFVDHRKALIQYILQQAVDRGEISSAAISDELWDLLPGYLIFRSIIPNRPPTQDTVQALVDDVILPSLTRSTG