pstB Family assigned · medium auto-curated

H37Rv Rv0933 · MTBC0 mtbc0_000991 · 276 aa · 1044481–1045311 (+) · RefSeq NP_215448.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphate ABC transporter ATP-binding protein PstB
MTBC0 PGAP re-annotationphosphate ABC transporter ATP-binding protein
Revised (this work)Phosphate ABC transporter ATP-binding protein. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQK9 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphate import ATP-binding protein PstB 2
EC (curated) EC 7.3.2.1
Curated functionPart of the ABC transporter complex PstSACB involved in phosphate import (Probable). Responsible for energy coupling to the transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namepstB
eggNOG descriptionPart of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the transport system
Orthologous groupCOG1117
EC number EC 3.6.3.27
KEGG orthology K02036
KEGG pathways map02010
KEGG modules M00222
Gene Ontology (31) GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0005524, GO:0005575, GO:0005623, GO:0005886, GO:0008144, GO:0016020, GO:0016462, GO:0016787 +19 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.032 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 10.04% of strains (14579) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 5.5e-2837–192 ABC transporter
AAA_21PF13304.13 1.7e-09161–222 AAA domain, putative AbiEii toxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pstC1 (phosphate ABC transporter permease PstC), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0935 pstC1 phosphate ABC transporter permease PstC 998 997 ctx neighborhood:597 cooccurence:774 coexpression:682 database:900 textmining:648
Rv0936 pstA2 phosphate ABC transporter permease PstA 997 996 ctx neighborhood:571 cooccurence:774 coexpression:677 database:900 textmining:457
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 997 995 ctx neighborhood:765 cooccurence:416 coexpression:664 database:900 textmining:454
Rv0930 pstA1 phosphate ABC transporter permease PstA 993 986 ctx cooccurence:773 coexpression:670 database:800 textmining:579
Rv0929 pstC2 phosphate ABC transporter permease PstC 992 985 ctx cooccurence:769 coexpression:670 database:800 textmining:536
Rv0932c pstS2 phosphate ABC transporter substrate-binding lipoprotein PstS 982 973 ctx neighborhood:513 coexpression:650 database:800
Rv0928 pstS3 phosphate ABC transporter substrate-binding lipoprotein PstS 970 952 coexpression:647 database:800 textmining:414
Rv0821c phoY2 phosphate-transport system transcriptional regulator PhoY2 966 921 ctx cooccurence:759 coexpression:668 textmining:588
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 972 920 ctx cooccurence:756 coexpression:669 textmining:671
Rv0820 phoT phosphate ABC transporter ATP-binding protein PhoT 908 908 database:900
Rv0931c pknD serine/threonine-protein kinase PknD 460 457 ctx neighborhood:451
Rv1437 pgk phosphoglycerate kinase 427 427
Rv0480c amidohydrolase 418 419 coexpression:419
Rv2150c ftsZ cell division protein FtsZ 448 415
Rv2438c nadE glutamine-dependent NAD(+) synthetase 415 415 coexpression:414

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphate ABC transporter ATP-binding protein PstB
  • MTBC0 PGAP product: phosphate ABC transporter ATP-binding protein
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=5e-28), AAA_21 PF13304.13 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215448.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1117
  • Curated reference: UniProt P9WQK9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor pstC1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000991|Rv0933|pstB
MACERLGGQSGAADVDAAAPAMAAVNLTLGFAGKTVLDQVSMGFPARAVTSLMGPTGSGKTTFLRTLNRMNDKVSGYRYSGDVLLGGRSIFNYRDVLEFRRRVGMLFQRPNPFPMSIMDNVLAGVRAHKLVPRKEFRGVAQARLTEVGLWDAVKDRLSDSPFRLSGGQQQLLCLARTLAVNPEVLLLDEPTSALDPTTTEKIEEFIRSLADRLTVIIVTHNLAQAARISDRAALFFDGRLVEEGPTEQLFSSPKHAETARYVAGLSGDVKDAKRGN