mscL Resolved · high auto-curated
H37Rv Rv0985c · MTBC0 mtbc0_001056 ·
151 aa · 1108361–1108816 (-) ·
RefSeq NP_215500.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | large-conductance ion mechanosensitive channel |
|---|---|
| MTBC0 PGAP re-annotation | large-conductance mechanosensitive channel protein MscL |
| Revised (this work) | Large-conductance mechanosensitive channel protein MscL. Pfam: MscL (PF01741.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJN5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large-conductance mechanosensitive channel |
| Curated function | Channel that opens in response to stretch forces in the membrane lipid bilayer. The force required to trigger channel opening depends on the nature of the membrane lipids; the presence of phosphatidylinositol enhances mechanosensitivity of the channel. May participate in the regulation of osmotic pressure changes within the cell. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | mscL |
| eggNOG description | Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell |
| Orthologous group | COG1970 |
| KEGG orthology |
K03282
|
| Gene Ontology (43) |
GO:0003674, GO:0005215, GO:0005488, GO:0005515, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006810, GO:0006811, GO:0006884, GO:0008150 +31 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.701 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MscL | PF01741.24 | 6.8e-33 | 1–122 | Large-conductance mechanosensitive channel, MscL |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0987 (adhesion component ABC transporter permease), medium confidence from genomic context alone (score 406 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1416 ribH |
6,7-dimethyl-8-ribityllumazine synthase | 988 | 987 | coexpression:987 |
Rv1392 metK |
S-adenosylmethionine synthetase | 945 | 945 | coexpression:945 |
Rv3396c guaA |
GMP synthase | 464 | 465 | |
Rv1380 pyrB |
aspartate carbamoyltransferase | 450 | 451 | coexpression:439 |
Rv2560 hyp |
hypothetical protein | 407 | 407 | coexpression:407 |
Rv3853 rraA |
RNase E regulator RraA | 429 | 406 | coexpression:406 |
Rv0987 |
adhesion component ABC transporter permease | 405 | 406 ctx | neighborhood:400 |
Rv0986 |
adhesion component ABC transporter ATP-binding protein | 459 | 403 | |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 815 | 307 | textmining:745 |
Rv2881c cdsA |
phosphatidate cytidylyltransferase | 459 | 193 | |
Rv0865 mog |
molybdopterin biosynthesis protein | 443 | 113 | |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 509 | 107 | textmining:473 |
Rv3104c |
transmembrane protein | 513 | 94 | textmining:485 |
Rv0917 betP |
glycine betaine transport integral membrane protein BetP | 491 | 93 | textmining:462 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 530 | 79 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: large-conductance ion mechanosensitive channel
- MTBC0 PGAP product: large-conductance mechanosensitive channel protein MscL
- Pfam (hmmscan --cut_ga): MscL PF01741.24 (E=7e-33)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215500.1)
- Domains: Pfam-A via hmmscan --cut_ga — MscL (PF01741.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1970 - Curated reference: UniProt P9WJN5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0987 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001056|Rv0985c|mscL MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ