Rv0466 Resolved · high auto-curated

H37Rv Rv0466 · MTBC0 mtbc0_000490 · 264 aa · 559823–560617 (+) · RefSeq NP_214980.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationacyl-[acyl-carrier-protein] thioesterase
Revised (this work)Acyl-[acyl-carrier-protein] thioesterase. Pfam: Acyl-ACP_TE (PF01643.24), Acyl-ACP_TE_C (PF20791.4).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53751 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionAcyl-ACP thioesterase
Orthologous groupCOG3884

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.162 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acyl-ACP_TEPF01643.24 1.5e-3816–137 Acyl-ACP thioesterase N-terminal domain
Acyl-ACP_TE_CPF20791.4 4.0e-24157–263 Acyl-ACP thioesterase C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprC (lipoprotein LprC), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1275 lprC lipoprotein LprC 774 774 ctx cooccurence:771
Rv1274 lprB lipoprotein LprB 770 770 ctx cooccurence:767
Rv3035 hyp hypothetical protein 761 761 ctx cooccurence:760
Rv0383c ttfA hyp hypothetical protein 754 754 ctx cooccurence:754
Rv0817c lmeA hyp hypothetical protein 747 748 ctx cooccurence:747
Rv1125 hyp hypothetical protein 744 744 ctx cooccurence:744
Rv1476 membrane protein 739 739 ctx cooccurence:737
Rv3668c protease 725 725 ctx cooccurence:724
Rv3802c membrane protein 722 723 ctx cooccurence:721
Rv2342 hyp hypothetical protein 720 720 ctx cooccurence:720
Rv3346c transmembrane protein 716 716 ctx cooccurence:715
Rv2672 protease 714 715 ctx cooccurence:713
Rv1610 membrane protein 710 711 ctx cooccurence:709
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 710 710 ctx cooccurence:706
Rv0184 hyp hypothetical protein 699 700 ctx cooccurence:698

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: acyl-[acyl-carrier-protein] thioesterase
  • Pfam (hmmscan --cut_ga): Acyl-ACP_TE PF01643.24 (E=1e-38), Acyl-ACP_TE_C PF20791.4 (E=4e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214980.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyl-ACP_TE (PF01643.24), Acyl-ACP_TE_C (PF20791.4)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3884
  • Curated reference: UniProt O53751 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor lprC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000490|Rv0466|
MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQDIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVDGRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASEIHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEIISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL