Rv0466 Resolved · high auto-curated
H37Rv Rv0466 · MTBC0 mtbc0_000490 ·
264 aa · 559823–560617 (+) ·
RefSeq NP_214980.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | acyl-[acyl-carrier-protein] thioesterase |
| Revised (this work) | Acyl-[acyl-carrier-protein] thioesterase. Pfam: Acyl-ACP_TE (PF01643.24), Acyl-ACP_TE_C (PF20791.4). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53751
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Acyl-ACP thioesterase |
| Orthologous group | COG3884 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.162 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acyl-ACP_TE | PF01643.24 | 1.5e-38 | 16–137 | Acyl-ACP thioesterase N-terminal domain |
Acyl-ACP_TE_C | PF20791.4 | 4.0e-24 | 157–263 | Acyl-ACP thioesterase C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: lprC (lipoprotein LprC), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1275 lprC |
lipoprotein LprC | 774 | 774 ctx | cooccurence:771 |
Rv1274 lprB |
lipoprotein LprB | 770 | 770 ctx | cooccurence:767 |
Rv3035 hyp |
hypothetical protein | 761 | 761 ctx | cooccurence:760 |
Rv0383c ttfA hyp |
hypothetical protein | 754 | 754 ctx | cooccurence:754 |
Rv0817c lmeA hyp |
hypothetical protein | 747 | 748 ctx | cooccurence:747 |
Rv1125 hyp |
hypothetical protein | 744 | 744 ctx | cooccurence:744 |
Rv1476 |
membrane protein | 739 | 739 ctx | cooccurence:737 |
Rv3668c |
protease | 725 | 725 ctx | cooccurence:724 |
Rv3802c |
membrane protein | 722 | 723 ctx | cooccurence:721 |
Rv2342 hyp |
hypothetical protein | 720 | 720 ctx | cooccurence:720 |
Rv3346c |
transmembrane protein | 716 | 716 ctx | cooccurence:715 |
Rv2672 |
protease | 714 | 715 ctx | cooccurence:713 |
Rv1610 |
membrane protein | 710 | 711 ctx | cooccurence:709 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 710 | 710 ctx | cooccurence:706 |
Rv0184 hyp |
hypothetical protein | 699 | 700 ctx | cooccurence:698 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: acyl-[acyl-carrier-protein] thioesterase
- Pfam (hmmscan --cut_ga): Acyl-ACP_TE PF01643.24 (E=1e-38), Acyl-ACP_TE_C PF20791.4 (E=4e-24)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214980.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acyl-ACP_TE (PF01643.24), Acyl-ACP_TE_C (PF20791.4)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3884 - Curated reference: UniProt O53751 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
82 functional partner(s); context anchor
lprC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000490|Rv0466| MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQDIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVDGRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASEIHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEIISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL