mpt83 Resolved · high auto-curated
H37Rv Rv2873 · MTBC0 mtbc0_003055 ·
220 aa · 3204571–3205233 (+) ·
RefSeq NP_217389.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cell surface lipoprotein |
|---|---|
| MTBC0 PGAP re-annotation | cell surface glycolipoprotein Mpt83 |
| Revised (this work) | Cell surface glycolipoprotein Mpt83. Pfam: Fasciclin (PF02469.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNF3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cell surface glycolipoprotein MPT83 |
| Curated function | Recombinant, non-modified protein stimulates secretion of cytokines (TNF, IL-6 and IL-12p40) by mouse macrophage cell lines in a TLR2-dependent fashion, which leads to increased host innate immunity responses against the bacterium. Serves as a strong human and mouse antigen T cell antigen during M.tuberculosis infection, inducing strong IFN-gamma expression. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | mpb |
| eggNOG description | Fasciclin |
| Orthologous group | COG2335 |
| Gene Ontology (28) |
GO:0005575, GO:0005576, GO:0005615, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0030288, GO:0030313, GO:0031975 +16 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fasciclin | PF02469.28 | 2.9e-28 | 96–217 | Fasciclin domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dxr (1-deoxy-D-xylulose 5-phosphate reductoisomerase), high confidence from genomic context alone (score 712 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 840 | 830 | experimental:829 |
Rv2870c dxr |
1-deoxy-D-xylulose 5-phosphate reductoisomerase | 711 | 712 ctx | neighborhood:711 |
Rv2869c rip |
zinc metalloprotease | 692 | 693 ctx | neighborhood:693 |
Rv2874 dipZ |
integral membrane C-type cytochrome biogenesis protein DipZ | 821 | 660 ctx | neighborhood:485 textmining:496 |
Rv2872 vapC43 |
ribonuclease VapC43 | 617 | 617 ctx | neighborhood:605 |
Rv2871 vapB43 |
antitoxin VapB43 | 565 | 564 ctx | neighborhood:562 |
Rv2868c gcpE |
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) | 554 | 554 ctx | neighborhood:550 |
Rv0445c sigK |
ECF RNA polymerase sigma factor SigK | 911 | 501 ctx | cooccurence:429 textmining:831 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 447 | 448 | experimental:446 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 447 | 448 | experimental:446 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 478 | 447 | experimental:446 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 447 | 447 | experimental:446 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 467 | 446 | experimental:446 |
Rv3155 nuoK |
NADH-quinone oxidoreductase subunit K | 446 | 446 | experimental:446 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 446 | 446 | experimental:446 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cell surface lipoprotein
- MTBC0 PGAP product: cell surface glycolipoprotein Mpt83
- Pfam (hmmscan --cut_ga): Fasciclin PF02469.28 (E=3e-28)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217389.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fasciclin (PF02469.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2335 - Curated reference: UniProt P9WNF3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
dxr - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003055|Rv2873|mpt83 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ