bpoC Family assigned · medium auto-curated
H37Rv Rv0554 · MTBC0 mtbc0_000583 ·
262 aa · 649018–649806 (+) ·
RefSeq NP_215068.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | non-heme bromoperoxidase BpoC |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16), Abhydrolase_4 (PF08386.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNH1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative non-heme bromoperoxidase BpoC |
UniProt still lists this protein as Putative non-heme bromoperoxidase BpoC; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | bpoC |
| eggNOG description | Alpha beta hydrolase |
| Orthologous group | COG2267 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.171 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 6.3e-25 | 14–246 | alpha/beta hydrolase fold |
Abhydrolase_6 | PF12697.14 | 1.2e-24 | 15–250 | Alpha/beta hydrolase family |
Hydrolase_4 | PF12146.16 | 7.8e-11 | 22–244 | Serine aminopeptidase, S33 |
Abhydrolase_4 | PF08386.17 | 5.5e-07 | 196–259 | TAP-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: menC (muconate cycloisomerase), high confidence from genomic context alone (score 882 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0553 menC |
muconate cycloisomerase | 887 | 882 ctx | neighborhood:882 |
Rv0552 hyp |
hypothetical protein | 878 | 878 ctx | neighborhood:878 |
Rv0555 menD |
bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase | 854 | 849 ctx | neighborhood:820 |
Rv0556 |
transmembrane protein | 821 | 821 ctx | neighborhood:820 |
Rv3171c hpx |
non-heme haloperoxidase Hpx | 728 | 728 ctx | cooccurence:728 |
Rv0557 mgtA |
GDP-mannose-dependent alpha-mannosyltransferase | 711 | 712 ctx | neighborhood:705 |
Rv0551c fadD8 |
fatty-acid--CoA ligase FadD8 | 661 | 660 ctx | neighborhood:614 |
Rv0548c menB |
1,4-dihydroxy-2-naphthoyl-CoA synthase | 642 | 629 ctx | neighborhood:623 |
Rv1930c hyp |
hypothetical protein | 596 | 597 ctx | neighborhood:544 |
Rv0134 ephF |
epoxide hydrolase EphF | 559 | 559 ctx | cooccurence:559 |
Rv1931c |
transcriptional regulator | 544 | 544 ctx | neighborhood:544 |
Rv0558 menH |
demethylmenaquinone methyltransferase | 526 | 526 ctx | neighborhood:526 |
Rv1527c pks5 |
polyketide synthase | 529 | 502 | experimental:441 |
Rv2048c pks12 |
polyketide synthase | 529 | 501 | experimental:441 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 529 | 501 | experimental:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: non-heme bromoperoxidase BpoC
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=6e-25), Abhydrolase_6 PF12697.14 (E=1e-24), Hydrolase_4 PF12146.16 (E=8e-11), Abhydrolase_4 PF08386.17 (E=6e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215068.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16), Abhydrolase_4 (PF08386.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2267 - Curated reference: UniProt P9WNH1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
menC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000583|Rv0554|bpoC MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA