bpoC Family assigned · medium auto-curated

H37Rv Rv0554 · MTBC0 mtbc0_000583 · 262 aa · 649018–649806 (+) · RefSeq NP_215068.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)non-heme bromoperoxidase BpoC
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16), Abhydrolase_4 (PF08386.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNH1 SwissProt · reviewed · Evidence at protein level
UniProt namePutative non-heme bromoperoxidase BpoC

UniProt still lists this protein as Putative non-heme bromoperoxidase BpoC; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namebpoC
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.171 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 6.3e-2514–246 alpha/beta hydrolase fold
Abhydrolase_6PF12697.14 1.2e-2415–250 Alpha/beta hydrolase family
Hydrolase_4PF12146.16 7.8e-1122–244 Serine aminopeptidase, S33
Abhydrolase_4PF08386.17 5.5e-07196–259 TAP-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: menC (muconate cycloisomerase), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0553 menC muconate cycloisomerase 887 882 ctx neighborhood:882
Rv0552 hyp hypothetical protein 878 878 ctx neighborhood:878
Rv0555 menD bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase 854 849 ctx neighborhood:820
Rv0556 transmembrane protein 821 821 ctx neighborhood:820
Rv3171c hpx non-heme haloperoxidase Hpx 728 728 ctx cooccurence:728
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 711 712 ctx neighborhood:705
Rv0551c fadD8 fatty-acid--CoA ligase FadD8 661 660 ctx neighborhood:614
Rv0548c menB 1,4-dihydroxy-2-naphthoyl-CoA synthase 642 629 ctx neighborhood:623
Rv1930c hyp hypothetical protein 596 597 ctx neighborhood:544
Rv0134 ephF epoxide hydrolase EphF 559 559 ctx cooccurence:559
Rv1931c transcriptional regulator 544 544 ctx neighborhood:544
Rv0558 menH demethylmenaquinone methyltransferase 526 526 ctx neighborhood:526
Rv1527c pks5 polyketide synthase 529 502 experimental:441
Rv2048c pks12 polyketide synthase 529 501 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 529 501 experimental:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: non-heme bromoperoxidase BpoC
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=6e-25), Abhydrolase_6 PF12697.14 (E=1e-24), Hydrolase_4 PF12146.16 (E=8e-11), Abhydrolase_4 PF08386.17 (E=6e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215068.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14), Hydrolase_4 (PF12146.16), Abhydrolase_4 (PF08386.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt P9WNH1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor menC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000583|Rv0554|bpoC
MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA