menH Resolved · high auto-curated

H37Rv Rv0558 · MTBC0 - · 234 aa · 649689–650393 (+) · RefSeq YP_177738.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)demethylmenaquinone methyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Demethylmenaquinone methyltransferase. Pfam: Ubie_methyltran (PF01209.25), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WFR3 SwissProt · reviewed · Evidence at protein level
UniProt nameDemethylmenaquinone methyltransferase
EC (curated) EC 2.1.1.163
Curated functionMethyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemenG
eggNOG descriptionMethyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2)
Orthologous groupCOG0500
EC number EC 2.1.1.163, EC 2.1.1.201
KEGG orthology K03183
KEGG pathways map00130, map01100, map01110
KEGG modules M00116, M00117
Gene Ontology (8) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.544 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ubie_methyltranPF01209.25 1.4e-5811–227 ubiE/COQ5 methyltransferase family
Methyltransf_23PF13489.13 1.8e-0738–167 Methyltransferase domain
Methyltransf_31PF13847.13 7.5e-1051–196 Methyltransferase domain
Methyltransf_25PF13649.13 3.1e-1455–141 Methyltransferase domain
Methyltransf_11PF08241.19 2.0e-1756–145 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mgtA (GDP-mannose-dependent alpha-mannosyltransferase), high confidence from genomic context alone (score 861 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0534c menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase 961 904 database:900 textmining:614
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 866 861 ctx neighborhood:861
Rv0555 menD bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase 982 643 ctx neighborhood:641 textmining:953
Rv0556 transmembrane protein 643 643 ctx neighborhood:641
Rv0553 menC muconate cycloisomerase 943 567 ctx neighborhood:567 textmining:874
Rv0554 bpoC non-heme bromoperoxidase BpoC 526 526 ctx neighborhood:526
Rv0562 grcC1 polyprenyl-diphosphate synthase GrcC 519 502 ctx cooccurence:446
Rv0552 hyp hypothetical protein 492 492 ctx neighborhood:492
Rv0989c grcC2 polyprenyl-diphosphate synthase GrcC 487 469 ctx cooccurence:417
Rv1622c cydB cytochrome D ubiquinol oxidase subunit II CydB 457 457
Rv1623c cydA cytochrome D ubiquinol oxidase subunit I CydA 495 435 ctx cooccurence:421
Rv1523 methyltransferase 425 425 ctx cooccurence:425
Rv0548c menB 1,4-dihydroxy-2-naphthoyl-CoA synthase 768 372 textmining:647
Rv0542c menE 2-succinylbenzoic acid--CoA ligase 624 364 textmining:434
Rv3215 entC isochorismate synthase 837 146 textmining:818

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): demethylmenaquinone methyltransferase
  • Pfam (hmmscan --cut_ga): Ubie_methyltran PF01209.25 (E=1e-58), Methyltransf_23 PF13489.13 (E=2e-07), Methyltransf_31 PF13847.13 (E=7e-10), Methyltransf_25 PF13649.13 (E=3e-14), Methyltransf_11 PF08241.19 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177738.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ubie_methyltran (PF01209.25), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt P9WFR3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor mgtA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0558|menH
MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEYLMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVALHAGYKPGKQTPQ