Rv0546c Family assigned · medium auto-curated

H37Rv Rv0546c · MTBC0 mtbc0_000575 · 128 aa · 641134–641520 (-) · RefSeq NP_215060.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationVOC family protein
Revised (this work)VOC family protein. Pfam: Glyoxalase (PF00903.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06412 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namegloA
eggNOG descriptionGlyoxalase bleomycin resistance protein dioxygenase
Orthologous groupCOG0346

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.236 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlyoxalasePF00903.32 1.2e-208–111 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0547c (oxidoreductase), medium confidence from genomic context alone (score 597 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0547c oxidoreductase 597 597 ctx neighborhood:590
Rv0545c pitA low-affinity inorganic phosphate transporter 526 526 ctx neighborhood:519
Rv0544c transmembrane protein 519 519 ctx neighborhood:513
Rv1473A transcriptional regulator 467 467 ctx cooccurence:467
Rv0548c menB 1,4-dihydroxy-2-naphthoyl-CoA synthase 425 426 ctx neighborhood:419
Rv0543c hyp hypothetical protein 410 410 ctx neighborhood:406
Rv0863 hyp hypothetical protein 560 167 textmining:494
Rv1159 pimE polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase 457 75 textmining:438
Rv2564 glnQ glutamine ABC transporter ATP-binding protein 808 69 textmining:803
Rv1080c greA transcription elongation factor GreA 522 56 textmining:515
Rv2224c caeA carboxylesterase A 439 49 textmining:435
Rv3274c fadE25 acyl-CoA dehydrogenase 549 47 textmining:547
Rv0108c hyp hypothetical protein 497 47 textmining:494
Rv0180c transmembrane protein 674 44 textmining:673
Rv1086 (2Z,6E)-farnesyl diphosphate synthase 618 42 textmining:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: VOC family protein
  • Pfam (hmmscan --cut_ga): Glyoxalase PF00903.32 (E=1e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215060.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase (PF00903.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0346
  • Curated reference: UniProt O06412 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv0547c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000575|Rv0546c|
MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQSLLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVTDPDGITLIFVEVPEGHPLRTDTRA