vapB3 Family assigned · medium auto-curated

H37Rv Rv0550c · MTBC0 mtbc0_000579 · 88 aa · 644189–644455 (-) · RefSeq NP_215064.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB3
MTBC0 PGAP re-annotationtype II toxin-antitoxin system CcdA family antitoxin
Revised (this work)Type II toxin-antitoxin system CcdA family antitoxin. Pfam: CcdA (PF07362.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ59 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB3
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC3.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPost-segregation antitoxin CcdA
Orthologous groupCOG5302
Gene Ontology (16) GO:0008150, GO:0009605, GO:0009607, GO:0040008, GO:0043207, GO:0044403, GO:0044419, GO:0045926, GO:0048519, GO:0050789, GO:0050896, GO:0051701 +4 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CcdAPF07362.19 2.8e-0619–61 Post-segregation antitoxin CcdA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC3 (ribonuclease VapC3), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0549c vapC3 ribonuclease VapC3 933 887 ctx neighborhood:882 textmining:436
Rv0551c fadD8 fatty-acid--CoA ligase FadD8 468 468 ctx neighborhood:466
Rv0548c menB 1,4-dihydroxy-2-naphthoyl-CoA synthase 417 417 ctx neighborhood:415
Rv0918 hyp hypothetical protein 444 55 textmining:436
Rv3188 hyp hypothetical protein 443 50 textmining:438
Rv2278 Rv2278, (MTCY339.32c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase s 549 47 textmining:547
Rv3189 hyp hypothetical protein 482 47 textmining:479
Rv0581 vapB26 antitoxin VapB26 439 46 textmining:437
Rv2656c prophage protein 511 44 textmining:510
Rv2355 Probable transposase; Rv2355, (MTCY98.24), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 547 42 textmining:547
Rv1398c vapB10 antitoxin VapB10 515 41 textmining:515
Rv0718 rpsH 30S ribosomal protein S8 510 41 textmining:510
Rv0661c vapC7 ribonuclease VapC7 433 41 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB3
  • MTBC0 PGAP product: type II toxin-antitoxin system CcdA family antitoxin
  • Pfam (hmmscan --cut_ga): CcdA PF07362.19 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215064.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CcdA (PF07362.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5302
  • Curated reference: UniProt P9WJ59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor vapC3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000579|Rv0550c|vapB3
MLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQAAISAELENSATDAWLEGLEPRSTGARHDDVLGAIDAARDEFEA