menB Resolved · high auto-curated

H37Rv Rv0548c · MTBC0 - · 314 aa · 639012–639956 H37Rv (-) · RefSeq NP_215062.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)1,4-dihydroxy-2-naphthoyl-CoA synthase
MTBC0 PGAP re-annotation
Revised (this work)1,4-dihydroxy-2-naphthoyl-CoA synthase. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 13 publications

13 TB publications mention this gene. 13 publication(s) discuss this gene (11 in a M. tuberculosis context).

Most recent 5 of 13.
PublicationDate
Reverse Vaccinology for Influenza A Virus: From Genome Sequencing to Vaccine Design. doi:10.1007/978-1-0716-3239-0_27 2023
RepTB: a gene ontology based drug repurposing approach for tuberculosis. doi:10.1186/s13321-018-0276-9 2018
Ligand-dependent active-site closure revealed in the crystal structure of Mycobacterium tuberculosis MenB complexed with product analogues. doi:10.1107/S1399004714019440 2014
Positive Phase 1 interim results for killed whole-virus HIV vaccine. doi:10.4161/hv.23607 2013
CoA Adducts of 4-Oxo-4-Phenylbut-2-enoates: Inhibitors of MenB from the M. tuberculosis Menaquinone Biosynthesis Pathway. doi:10.1021/ml200141e 2011

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -3.81 (95% CI -4.32 to -3.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in menaquinone biosynthesis. Convert O-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2-naphthoic acid (DHNA) [catalytic activity: O-succinylbenzoyl-CoA = 1,4-dihydroxy-2-naphthoate + CoA].
Mycobrowser EC 4.1.3.36 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0562c · 99.7% identity
M. leprae ML2263c · 93.3% identity
M. marinum MMAR_0895 · 93.7% identity
M. smegmatis MSMEG_1075 · 86.0% identity
M. orygis RJtmp_000576 · 99.7% identity
M. abscessus MAB_3945 · 82.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WNP5 SwissProt · reviewed · Evidence at protein level
UniProt name1,4-dihydroxy-2-naphthoyl-CoA synthase
EC (curated) EC 4.1.3.36
Curated functionConverts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemenB
eggNOG descriptionBelongs to the enoyl-CoA hydratase isomerase family. MenB subfamily
Orthologous groupCOG0447
EC number EC 4.1.3.36
KEGG orthology K01661
KEGG pathways map00130, map01100, map01110
KEGG modules M00116
Gene Ontology (40) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006732, GO:0008150, GO:0008152, GO:0008935, GO:0009058, GO:0009108, GO:0009233 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 92.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 71.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 13 in the ORF — 11 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.154, mean read count 88. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainmenB_DAS_10555 (TetON promoter -)
Used in target deconvolutionno (Excluded - not in all screening waves)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance638.0 ppm · rank 340/3519 (90.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length314 aa
Molecular weight34.7 kDa
Theoretical pI5.99
GRAVY-0.304 (hydrophilic)
Aliphatic index75.5
Aromaticity0.102
Instability index37.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ECH_1PF00378.26 5.9e-4848–308 Enoyl-CoA hydratase/isomerase
ECH_2PF16113.11 4.9e-1449–249 Enoyl-CoA hydratase/isomerase

Experimental structures (Protein Data Bank) 8 solved

PDBMethodResolutionCoverage
4qii X-ray diffraction 1.64 Å 100%
3t8b X-ray diffraction 1.649 Å 100%
1q52 X-ray diffraction 1.8 Å 100%
1rjm X-ray diffraction 2.15 Å 100%
4qij X-ray diffraction 2.2 Å 100%
3t8a X-ray diffraction 2.245 Å 100%
1q51 X-ray diffraction 2.3 Å 100%
1rjn X-ray diffraction 2.3 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (8 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.9

PDB hitprobTM-scoreE-valueDescription
4qii-assembly1_B 1.00 0.99 1.8e-60 sig 4qii-assembly1_B Crystal Structure of type II MenB from Mycobacteria tuberculosis
1q51-assembly1_B 1.00 0.98 4.9e-55 sig 1q51-assembly1_B Crystal Structure of Mycobacterium tuberculosis MenB in Complex with Acetoacetyl-Coenzyme A, a Key Enzyme in Vitamin K2 Biosynthesis
1rjn-assembly1_B-2 1.00 0.99 1.4e-53 sig 1rjn-assembly1_B-2 The Crystal Structure of MenB (Rv0548c) from Mycobacterium tuberculosis in Complex with the CoA Portion of Naphthoyl CoA
3t8a-assembly1_B-2 1.00 0.99 3.5e-53 sig 3t8a-assembly1_B-2 Crystal structure of Mycobacterium tuberculosis MenB in complex with substrate analogue, OSB-NCoA
1q51-assembly1_D 1.00 1.00 1.7e-52 sig 1q51-assembly1_D Crystal Structure of Mycobacterium tuberculosis MenB in Complex with Acetoacetyl-Coenzyme A, a Key Enzyme in Vitamin K2 Biosynthesis

Foldseek search of the AlphaFold DB model (mean pLDDT 93.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry346 · EC 4.1.3.36
Catalytic residues6/6 identical (6/6 aligned)
VerdictACTIVE-SITE CONSERVED (6/6 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0547c (- strand, 95 bp gap)
Downstream (3' on genome)vapC3 (- strand, 271 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv1353c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: menE (2-succinylbenzoic acid--CoA ligase), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0542c menE exp 2-succinylbenzoic acid--CoA ligase 994 971 ctx cooccurence:569 database:900 textmining:816
Rv1847 exp esterase 974 927 database:900 textmining:659
Rv0555 menD bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase 992 881 ctx neighborhood:419 cooccurence:770 textmining:935
Rv0553 menC muconate cycloisomerase 974 862 ctx neighborhood:631 cooccurence:641 textmining:825
Rv0534c menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase 938 810 ctx cooccurence:767 textmining:688
Rv0544c transmembrane protein 677 677 ctx neighborhood:667
Rv0547c oxidoreductase 662 662 ctx neighborhood:657
Rv0551c fadD8 fatty-acid--CoA ligase FadD8 670 656 ctx neighborhood:654
Rv0554 bpoC non-heme bromoperoxidase BpoC 642 629 ctx neighborhood:623
Rv0552 hyp hypothetical protein 614 615 ctx neighborhood:615
Rv3039c echA17 enoyl-CoA hydratase EchA17 587 587 ctx cooccurence:584
Rv0456c echA2 enoyl-CoA hydratase EchA2 547 547 ctx cooccurence:546
Rv3373 echA18 enoyl-CoA hydratase 494 494 ctx cooccurence:489
Rv1449c tkt transketolase 432 433 coexpression:433
Rv0545c pitA low-affinity inorganic phosphate transporter 430 430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 1,4-dihydroxy-2-naphthoyl-CoA synthase
  • Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=6e-48), ECH_2 PF16113.11 (E=5e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215062.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0447
  • Curated reference: UniProt P9WNP5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.9)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 346; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor menE
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0548c|menB
MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF