Rv0541c Family assigned · low auto-curated

H37Rv Rv0541c · MTBC0 mtbc0_000570 · 449 aa · 636606–637955 (-) · RefSeq NP_215055.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationintegral membrane protein
Revised (this work)Integral membrane protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06407 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28KB1

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: menE (2-succinylbenzoic acid--CoA ligase), high confidence from genomic context alone (score 935 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0542c menE 2-succinylbenzoic acid--CoA ligase 934 935 ctx neighborhood:876 coexpression:494
Rv0540 hyp hypothetical protein 974 811 ctx cooccurence:771 textmining:870
Rv0536 galE3 UDP-glucose 4-epimerase GalE 974 809 ctx cooccurence:767 textmining:870
Rv1713 engA GTPase Der 808 808 coexpression:808
Rv0218 transmembrane protein 802 802 ctx cooccurence:767
Rv0543c hyp hypothetical protein 797 797 ctx neighborhood:792
Rv0539 dolichyl-phosphate sugar synthase 971 793 ctx cooccurence:741 textmining:870
Rv0219 transmembrane protein 761 761 ctx cooccurence:720
Rv1714 oxidoreductase 759 759 coexpression:759
Rv0545c pitA low-affinity inorganic phosphate transporter 745 745 ctx neighborhood:738
Rv0544c transmembrane protein 743 743 ctx neighborhood:738
Rv0547c oxidoreductase 639 638 ctx neighborhood:635
Rv1868 hyp hypothetical protein 581 582 ctx cooccurence:580
Rv1748 hyp hypothetical protein 569 569 ctx cooccurence:569
Rv1006 hyp hypothetical protein 552 552 ctx cooccurence:540

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: integral membrane protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215055.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KB1
  • Curated reference: UniProt O06407 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor menE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000570|Rv0541c|
MRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATRAGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSLAMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPGALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPTAIWIAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIVLPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDRPFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSMLSKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW