Rv0566c Family assigned · medium auto-curated

H37Rv Rv0566c · MTBC0 mtbc0_000595 · 163 aa · 661099–661590 (-) · RefSeq NP_215080.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYajQ family cyclic di-GMP-binding protein
Revised (this work)YajQ family cyclic di-GMP-binding protein. Pfam: YajQ (PF04461.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFK9 SwissProt · reviewed · Evidence at protein level
UniProt nameNucleotide-binding protein Rv0566c
Curated functionNucleotide-binding protein.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nametrpF
eggNOG descriptionBelongs to the UPF0234 family
Orthologous groupCOG1666
KEGG orthology K09767
Gene Ontology (11) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0044424, GO:0044444, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.296 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YajQPF04461.19 1.4e-624–163 Nucleotide-binding protein YajQ-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0565c (monooxygenase), high confidence from genomic context alone (score 934 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0565c monooxygenase 934 934 ctx neighborhood:788 coexpression:703
Rv0564c gpdA1 glycerol-3-phosphate dehydrogenase 735 735 ctx neighborhood:734
Rv1392 metK S-adenosylmethionine synthetase 432 433 coexpression:423
Rv0567 methyltransferase/methylase 429 429 ctx neighborhood:423
Rv2033c hyp hypothetical protein 435 78 textmining:413
Rv0360c hyp hypothetical protein 418 50 textmining:413
Rv0421c hyp hypothetical protein 414 44 textmining:413
Rv2676c hemQ hyp hypothetical protein 412 41 textmining:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: YajQ family cyclic di-GMP-binding protein
  • Pfam (hmmscan --cut_ga): YajQ PF04461.19 (E=1e-62)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215080.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YajQ (PF04461.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1666
  • Curated reference: UniProt P9WFK9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor Rv0565c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000595|Rv0566c|
MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKGDEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISSENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR