fgd1 Resolved · high auto-curated
H37Rv Rv0407 · MTBC0 mtbc0_000427 ·
336 aa ·
494148–495158 MTBC0
(+) ·
RefSeq NP_214921.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | F420-dependent glucose-6-phosphate dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | glucose-6-phosphate dehydrogenase (coenzyme-F420) |
| Revised (this work) | Glucose-6-phosphate dehydrogenase (coenzyme-F420). Pfam: Bac_luciferase (PF00296.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 33 publications
33 TB publications mention this gene. 33 publication(s) discuss this gene (33 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).
| Publication | Date |
|---|---|
| Resistance to Linezolid and Pretomanid in the Era of Modern Drug-Resistant Tuberculosis Treatment in South Africa: A Systematic Review and Meta-Analysis. doi:10.3390/antibiotics15060543 | 2026 |
| Molecular Mechanisms of Resistance and Treatment Efficacy of Delamanid Against Mycobacterium tuberculosis: A Systematic Review. doi:10.1002/hsr2.72481 | 2026 |
| Delamanid or pretomanid for treatment of multidrug resistant tuberculosis---spoilt for choice? doi:10.1016/j.ijtb.2025.09.005 | 2026 |
| Elucidating the structural basis of Fgd1-mediated resistance to Delamanid in Mycobacterium tuberculosis. doi:10.1016/j.jmgm.2026.109382 | 2026 |
| Spontaneous mutations to delamanid and pretomanid resistance in Mycobacterium tuberculosis: SNPs confer high-level resistance. doi:10.1016/j.ijantimicag.2026.107789 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | pta (Rv0408, + strand) |
|---|---|
| Overlap | 8 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -1.21 (95% CI -6.48 to 5.33). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Catalyzes oxidation of glucose-6-phosphate to 6-phosphogluconolactone using coenzyme F420 (an *-hydroxy-5-deazaflavin derivative) as the electron acceptor. |
|---|---|
| Mycobrowser EC |
1.-.-.-
· superseded EC numbering; the atlas uses the current class (1.1.98.2)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0415
· 99.7% identity |
|---|---|
| M. leprae |
ML0269c
· 89.0% identity |
| M. marinum |
MMAR_0709
· 90.5% identity |
| M. smegmatis |
MSMEG_0777
· 89.3% identity |
| M. orygis |
RJtmp_000427
· 99.4% identity |
| M. abscessus |
MAB_4230c
· 85.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNE1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | F420-dependent glucose-6-phosphate dehydrogenase |
| EC (curated) |
EC 1.1.98.2
|
| Curated function | Catalyzes the coenzyme F420-dependent oxidation of glucose 6-phosphate to 6-phosphogluconolactone. Appears to have a role in resistance to oxidative stress, via its consumption of G6P that serves as a source of reducing power to combat oxidative stress in mycobacteria. More precisely, is likely involved in a F420-dependent anti-oxidant mechanism that protects M.tuberculosis against oxidative stress and bactericidal agents..; FUNCTION: Is essential for the bioreductive activation of the bicyclic 4-nitroimidazole prodrug PA-824 (a nitroimidazo-oxazine) developed for anti-tuberculosis therapy aga. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | fgd |
| eggNOG description | Catalyzes the coenzyme F420-dependent oxidation of glucose 6-phosphate (G6P) to 6-phosphogluconolactone. Appears to have a role in resistance to oxidative stress, via its consumption of G6P that serves as a source of reducing power to combat oxidative stress in mycobacteria |
| Orthologous group | COG2141 |
| EC number |
EC 1.1.98.2
|
| KEGG orthology |
K15510
|
| Gene Ontology (44) |
GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150 +32 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.656 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.164 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 90.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 73.3% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 20 in the ORF — 0 in the essential state, 0 growth-defect, 20 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 101. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -3.96 | 0.0 | required |
| altered fitness under 6 weeks hypoxia (stress) | -2.91 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.37 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | -2.10 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.91 | 0.006 | required |
| fitness in mouse infection (in vivo) | -1.88 | 0.024 | required |
| fitness in mouse infection (in vivo) | -1.86 | 0.012 | required |
| fitness in mouse infection (in vivo) | -1.58 | 0.021 | required |
| fitness in mouse infection (in vivo) | +1.14 | 0.016 | disruption advantageous |
| altered fitness under 3 weeks hypoxia (stress) | -1.04 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 10 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Drug resistance (WHO catalogue) delamanid
| delamanid | 113 catalogued resistance-associated variant(s) |
|---|
This gene carries mutations classed Associated with resistance (WHO grade 1–2) in the consolidated catalogue (WHO 2nd ed. 2023 + tb-profiler). Only the R-associated tier is shown; "uncertain" and empirical-only signals are excluded. Test a specific strain or variant with the resistance tester. Research context, not a clinical diagnostic.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 176.0 ppm · rank 912/3519 (74.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 336 aa |
|---|---|
| Molecular weight | 37.0 kDa |
| Theoretical pI | 5.28 |
| GRAVY | -0.247 (hydrophilic) |
| Aliphatic index | 81.7 |
| Aromaticity | 0.098 |
| Instability index | 33.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Bac_luciferase | PF00296.27 | 4.6e-67 | 11–306 | Luciferase-like monooxygenase |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3c8n |
X-ray diffraction | 1.9 Å | 100% |
3b4y |
X-ray diffraction | 1.95 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3c8n-assembly2_C |
1.00 | 0.99 | 1.7e-61 sig | 3c8n-assembly2_C Crystal structure of apo-FGD1 from Mycobacterium tuberculosis |
3c8n-assembly2_D |
1.00 | 0.99 | 1.1e-61 sig | 3c8n-assembly2_D Crystal structure of apo-FGD1 from Mycobacterium tuberculosis |
3c8n-assembly1_A |
1.00 | 0.99 | 2.7e-61 sig | 3c8n-assembly1_A Crystal structure of apo-FGD1 from Mycobacterium tuberculosis |
3c8n-assembly1_B |
1.00 | 0.98 | 8.8e-61 sig | 3c8n-assembly1_B Crystal structure of apo-FGD1 from Mycobacterium tuberculosis |
5lxe-assembly1_A |
1.00 | 0.97 | 4.6e-51 sig | 5lxe-assembly1_A F420-dependent glucose-6-phosphate dehydrogenase from Rhodococcus jostii RHA1 |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) active site conserved
| M-CSA entry | 532 · EC 1.1.98.5 |
|---|---|
| Catalytic residues | 3/3 identical (3/3 aligned) |
| Verdict | ACTIVE-SITE CONSERVED (3/3 catalytic residues identical) -> likely active enzyme |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv0406c (- strand, 77 bp gap) |
|---|---|
| Downstream (3' on genome) | pta (+ strand, -8 bp gap) |
| Predicted operon |
fgd1 · pta · ackA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1776c (represses) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pta (phosphate acetyltransferase), high confidence from genomic context alone (score 889 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0408 pta |
phosphate acetyltransferase | 903 | 889 ctx | neighborhood:882 |
Rv0409 ackA |
acetate kinase | 889 | 889 ctx | neighborhood:882 |
Rv0406c |
beta lactamase-like protein | 787 | 787 ctx | neighborhood:784 |
Rv0044c |
oxidoreductase | 804 | 777 ctx | cooccurence:771 |
Rv3261 fbiA |
2-phospho-L-lactate transferase | 990 | 747 ctx | cooccurence:728 textmining:965 |
Rv3547 ddn |
deazaflavin-dependent nitroreductase | 983 | 745 ctx | cooccurence:745 textmining:936 |
Rv3178 |
nitroreductase | 953 | 745 ctx | cooccurence:745 textmining:824 |
Rv1558 hyp |
hypothetical protein | 949 | 745 ctx | cooccurence:745 textmining:812 |
Rv1261c hyp |
hypothetical protein | 845 | 741 ctx | cooccurence:739 textmining:430 |
Rv2983 cofC |
2-phospho-L-lactate guanylyltransferase | 970 | 689 ctx | cooccurence:677 textmining:909 |
Rv3262 fbiB |
coenzyme F420:L-glutamate ligase | 988 | 685 ctx | cooccurence:641 textmining:965 |
Rv2161c hyp |
hypothetical protein | 645 | 645 ctx | cooccurence:641 |
Rv3093c |
oxidoreductase | 604 | 604 ctx | cooccurence:602 |
Rv3079c hyp |
hypothetical protein | 594 | 595 ctx | cooccurence:585 |
Rv3072c hyp |
hypothetical protein | 591 | 568 ctx | cooccurence:567 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: F420-dependent glucose-6-phosphate dehydrogenase
- MTBC0 PGAP product: glucose-6-phosphate dehydrogenase (coenzyme-F420)
- Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=5e-67)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214921.1)
- Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2141 - Curated reference: UniProt P9WNE1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.1)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 532; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
pta - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Drug resistance: consolidated catalogue, WHO 2nd ed. 2023 (9789240082410) + tb-profiler; only the resistance-associated tier (grade 1–2) is surfaced
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000427|Rv0407|fgd1 MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for fgd1? Email the maintainer — the message is pre-filled with this gene's details.