thiO Resolved · high auto-curated

H37Rv Rv0415 · MTBC0 mtbc0_000435 · 340 aa · 504513–505535 (+) · RefSeq NP_214929.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thiamine biosynthesis oxidoreductase ThiO
MTBC0 PGAP re-annotationglycine oxidase ThiO
Revised (this work)Glycine oxidase ThiO. Pfam: DAO (PF01266.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96261 TrEMBL · unreviewed · Evidence at protein level
UniProt nameglycine oxidase
EC (curated) EC 1.4.3.19

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namethiO
eggNOG descriptionGlycine oxidase
Orthologous groupCOG0665
EC number EC 1.4.3.19
KEGG orthology K03153
KEGG pathways map00730, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.458 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAOPF01266.31 3.7e-5510–329 FAD dependent oxidoreductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thiG (thiazole synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0417 thiG thiazole synthase 999 1000 ctx neighborhood:881 fusion:838 cooccurence:709 coexpression:461 database:900 textmining:949
Rv0416 thiS sulfur carrier protein ThiS 986 929 ctx neighborhood:881 coexpression:430 textmining:817
Rv0414c thiE thiamine-phosphate synthase 888 873 ctx neighborhood:776 cooccurence:412
Rv0331 dehydrogenase/reductase 853 834 experimental:821
Rv2211c gcvT aminomethyltransferase 844 823 experimental:773
Rv3671c marP serine protease 627 622 database:549
Rv3339c icd1 isocitrate dehydrogenase 619 599 database:576
Rv1872c lldD2 L-lactate dehydrogenase 614 590 database:551
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 613 589 database:551
Rv0125 pepA serine protease PepA 568 563 database:549
Rv1223 htrA serine protease HtrA 567 562 database:549
Rv0983 pepD serine protease PepD 567 562 database:549
Rv1043c hyp hypothetical protein 564 559 database:549
Rv3672c hyp hypothetical protein 562 546 database:524
Rv2609c membrane protein 559 543 database:524

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thiamine biosynthesis oxidoreductase ThiO
  • MTBC0 PGAP product: glycine oxidase ThiO
  • Pfam (hmmscan --cut_ga): DAO PF01266.31 (E=4e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214929.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAO (PF01266.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0665
  • Curated reference: UniProt P96261 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 89 functional partner(s); context anchor thiG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000435|Rv0415|thiO
MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASWVAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADVADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDCERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLPQRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEYELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS