thiO Resolved · high auto-curated
H37Rv Rv0415 · MTBC0 mtbc0_000435 ·
340 aa ·
504513–505535 MTBC0
(+) ·
RefSeq NP_214929.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thiamine biosynthesis oxidoreductase ThiO |
|---|---|
| MTBC0 PGAP re-annotation | glycine oxidase ThiO |
| Revised (this work) | Glycine oxidase ThiO. Pfam: DAO (PF01266.31). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 87 publications
87 TB publications mention this gene. 87 publication(s) discuss this gene (71 in a M. tuberculosis context, 11 in other mycobacteria — M. smegmatis (8), M. abscessus (1), M. leprae (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Super-Armed Thiomannopyranosides in the Synthesis of a Mannose-Capped Trisaccharide of Mycobacterium tuberculosis Lipoarabinomannan. doi:10.3390/molecules31101598 | 2026 |
| QSAR-based drug discovery of 2-((4-Imino-3,4-dihydroquinazolin-2-yl)thio-substituted analogs targeting Mycobacterium tuberculosis. doi:10.1016/j.bmc.2026.118572 | 2026 |
| 5-Substituted 4-Thiouridines, 4-Thio-2'-deoxyuridines and Their Oligoglycol Carbonate Prodrugs as Promising Antimicrobial Agents. doi:10.3390/ijms262311712 | 2025 |
| Synthesis of S- or N-glycomimetics of D-galactono-1,4-lactone: inhibitors of a β-galactofuranosidase. doi:10.1039/d5ob01674f | 2026 |
| Crystal structure, Hirshfeld surface, DFT and mol-ecular docking studies of 2-{4-[(E)-(4-acetylphen-yl)diazen-yl]phen-yl}-1-(5-bromo-thio-phen-2-yl)ethanone; a compound with bromine⋯oxygen-type contacts. doi:10.1107/S2056989024010776 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | thiS (Rv0416, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -7.54 (95% CI -7.78 to -7.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly involved in thiamine biosynthesis. |
|---|---|
| Mycobrowser EC |
1.-.-.-
· superseded EC numbering; the atlas uses the current class (1.4.3.19)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0423
· 99.7% identity |
|---|---|
| M. leprae |
ML0299c
· 82.0% identity |
| M. marinum |
MMAR_0718
· 84.9% identity |
| M. smegmatis |
MSMEG_0791
· 79.3% identity |
| M. orygis |
RJtmp_000435
· 100.0% identity |
| M. abscessus |
MAB_4218c
· 67.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P96261
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | glycine oxidase |
| EC (curated) |
EC 1.4.3.19
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | thiO |
| eggNOG description | Glycine oxidase |
| Orthologous group | COG0665 |
| EC number |
EC 1.4.3.19
|
| KEGG orthology |
K03153
|
| KEGG pathways |
map00730, map01100
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.458 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 12 in the ORF — 12 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0415-thiO-TetOn18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.868 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 20.3 ppm · rank 2336/3519 (33.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 340 aa |
|---|---|
| Molecular weight | 36.5 kDa |
| Theoretical pI | 6.15 |
| GRAVY | 0.014 (hydrophobic) |
| Aliphatic index | 103.5 |
| Aromaticity | 0.047 |
| Instability index | 42.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DAO | PF01266.31 | 3.7e-55 | 10–329 | FAD dependent oxidoreductase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6j39-assembly1_A |
1.00 | 0.84 | 3.6e-27 sig | 6j39-assembly1_A Crystal structure of CmiS2 with inhibitor |
6j39-assembly1_B-2 |
1.00 | 0.81 | 8.1e-27 sig | 6j39-assembly1_B-2 Crystal structure of CmiS2 with inhibitor |
6j38-assembly1_B-2 |
1.00 | 0.83 | 2.0e-26 sig | 6j38-assembly1_B-2 Crystal structure of CmiS2 |
4ysh-assembly1_A |
1.00 | 0.85 | 1.2e-25 sig | 4ysh-assembly1_A Crystal structure of glycine oxidase from Geobacillus kaustophilus |
3if9-assembly1_A-2 |
1.00 | 0.82 | 2.3e-24 sig | 3if9-assembly1_A-2 Crystal structure of Glycine Oxidase G51S/A54R/H244A mutant in complex with inhibitor glycolate |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | thiE (- strand, 129 bp gap) |
|---|---|
| Downstream (3' on genome) | thiS (+ strand, -4 bp gap) |
| Predicted operon |
thiO · thiS · thiG
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: thiG (thiazole synthase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0417 thiG exp |
thiazole synthase | 999 | 1000 ctx | neighborhood:881 fusion:838 cooccurence:709 coexpression:461 database:900 textmining:949 |
Rv0416 thiS |
sulfur carrier protein ThiS | 986 | 929 ctx | neighborhood:881 coexpression:430 textmining:817 |
Rv0414c thiE |
thiamine-phosphate synthase | 888 | 873 ctx | neighborhood:776 cooccurence:412 |
Rv0331 exp |
dehydrogenase/reductase | 853 | 834 | experimental:821 |
Rv2211c gcvT exp |
aminomethyltransferase | 844 | 823 | experimental:773 |
Rv3671c marP exp |
serine protease | 627 | 622 | database:549 |
Rv3339c icd1 exp |
isocitrate dehydrogenase | 619 | 599 | database:576 |
Rv1872c lldD2 exp |
L-lactate dehydrogenase | 614 | 590 | database:551 |
Rv0694 mftD exp |
mycofactocin system heme/flavin oxidoreductase MftD | 613 | 589 | database:551 |
Rv0125 pepA exp |
serine protease PepA | 568 | 563 | database:549 |
Rv1223 htrA exp |
serine protease HtrA | 567 | 562 | database:549 |
Rv0983 pepD exp |
serine protease PepD | 567 | 562 | database:549 |
Rv1043c hyp exp |
hypothetical protein | 564 | 559 | database:549 |
Rv3672c hyp exp |
hypothetical protein | 562 | 546 | database:524 |
Rv2609c exp |
membrane protein | 559 | 543 | database:524 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thiamine biosynthesis oxidoreductase ThiO
- MTBC0 PGAP product: glycine oxidase ThiO
- Pfam (hmmscan --cut_ga): DAO PF01266.31 (E=4e-55)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214929.1)
- Domains: Pfam-A via hmmscan --cut_ga — DAO (PF01266.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0665 - Curated reference: UniProt P96261 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
89 functional partner(s); context anchor
thiG - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000435|Rv0415|thiO MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASWVAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADVADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDCERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLPQRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEYELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for thiO? Email the maintainer — the message is pre-filled with this gene's details.