thiE Resolved · high auto-curated

H37Rv Rv0414c · MTBC0 mtbc0_000434 · 222 aa · 503715–504383 (-) · RefSeq NP_214928.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thiamine-phosphate synthase
MTBC0 PGAP re-annotationthiamine phosphate synthase
Revised (this work)Thiamine phosphate synthase. Pfam: TMP-TENI (PF02581.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG75 SwissProt · reviewed · Evidence at protein level
UniProt nameThiamine-phosphate synthase
EC (curated) EC 2.5.1.3
Curated functionCondenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monophosphate (TMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namethiE
eggNOG descriptionCondenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monophosphate (TMP)
Orthologous groupCOG0352
EC number EC 2.5.1.3
KEGG orthology K00788
KEGG pathways map00730, map01100
KEGG modules M00127
Gene Ontology (45) GO:0003674, GO:0003824, GO:0004789, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006725, GO:0006766, GO:0006767, GO:0006772, GO:0006790 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.192 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TMP-TENIPF02581.24 1.7e-5311–201 Thiamine monophosphate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thiD (hydroxymethylpyrimidine/phosphomethylpyrimidine kinase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0422c thiD hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 999 999 ctx fusion:895 cooccurence:765 coexpression:742 database:900 textmining:595
Rv0417 thiG thiazole synthase 994 990 ctx neighborhood:774 cooccurence:735 coexpression:852 textmining:434
Rv0416 thiS sulfur carrier protein ThiS 958 953 ctx neighborhood:776 coexpression:798
Rv2977c thiL thiamine-monophosphate kinase 944 908 database:900 textmining:419
Rv3228 rsgA hyp hypothetical protein 913 901 database:900
Rv0423c thiC phosphomethylpyrimidine synthase 902 873 coexpression:809
Rv0415 thiO thiamine biosynthesis oxidoreductase ThiO 888 873 ctx neighborhood:776 cooccurence:412
Rv1173 fbiC FO synthase 850 804 coexpression:788
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 683 567 coexpression:441
Rv1355c moeY molybdopterin biosynthesis protein MoeY 576 542 coexpression:441
Rv2338c moeW molybdopterin biosynthesis protein MoeW 574 540 coexpression:441
Rv3859c gltB glutamate synthase large subunit 513 513 ctx neighborhood:513
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 640 508 coexpression:441
Rv2337c hyp hypothetical protein 501 461 coexpression:443
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 455 455 coexpression:455

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thiamine-phosphate synthase
  • MTBC0 PGAP product: thiamine phosphate synthase
  • Pfam (hmmscan --cut_ga): TMP-TENI PF02581.24 (E=2e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214928.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TMP-TENI (PF02581.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0352
  • Curated reference: UniProt P9WG75 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor thiD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000434|Rv0414c|thiE
MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN