thiE Resolved · high auto-curated
H37Rv Rv0414c · MTBC0 mtbc0_000434 ·
222 aa ·
503715–504383 MTBC0
(-) ·
RefSeq NP_214928.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thiamine-phosphate synthase |
|---|---|
| MTBC0 PGAP re-annotation | thiamine phosphate synthase |
| Revised (this work) | Thiamine phosphate synthase. Pfam: TMP-TENI (PF02581.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Petri Net modeling of thiamine diphosphate biosynthesis in Mycobacterium tuberculosis H37Rv. doi:10.6026/973206300211029 | 2025 |
| Thiamin (vitamin B1) biosynthesis and regulation: a rich source of antimicrobial drug targets? doi:10.7150/ijbs.7.41 | 2011 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 3 % of gene
| Neighbour | mutT3 (Rv0413, + strand) |
|---|---|
| Overlap | 17 bp, 3 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.28 (95% CI -0.48 to -0.09). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in thiamine biosynthesis. Condenses 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate (THZ-P) and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-pp) to form thiamine monophosphate (TMP) [catalytic activity: 2-methyl-4-amino-5-hydroxymethylpyrimidine diphosphate + 4-4-methyl-5-(2-phosphonooxyethyl)-thiazole = diphosphate + thiamine monophosphate]. |
|---|---|
| Mycobrowser EC |
2.5.1.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0422c
· 99.5% identity |
|---|---|
| M. leprae |
ML0300
· 78.7% identity |
| M. marinum |
MMAR_0717
· 80.5% identity |
| M. smegmatis |
MSMEG_0789
· 72.8% identity |
| M. orygis |
RJtmp_000434
· 99.5% identity |
| M. abscessus |
MAB_4219
· 72.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WG75
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Thiamine-phosphate synthase |
| EC (curated) |
EC 2.5.1.3
|
| Curated function | Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monophosphate (TMP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | thiE |
| eggNOG description | Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monophosphate (TMP) |
| Orthologous group | COG0352 |
| EC number |
EC 2.5.1.3
|
| KEGG orthology |
K00788
|
| KEGG pathways |
map00730, map01100
|
| KEGG modules |
M00127
|
| Gene Ontology (45) |
GO:0003674, GO:0003824, GO:0004789, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006725, GO:0006766, GO:0006767, GO:0006772, GO:0006790 +33 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.192 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 80.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 10 in the ORF — 9 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.100, mean read count 95. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0414c-thiE-TetOn18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.607 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 50.0 ppm · rank 1756/3519 (50.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 222 aa |
|---|---|
| Molecular weight | 23.3 kDa |
| Theoretical pI | 5.81 |
| GRAVY | -0.054 (hydrophilic) |
| Aliphatic index | 95.7 |
| Aromaticity | 0.045 |
| Instability index | 33.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TMP-TENI | PF02581.24 | 1.7e-53 | 11–201 | Thiamine monophosphate synthase |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3o63 |
X-ray diffraction | 2.35 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3o63-assembly1_A-2 |
1.00 | 0.98 | 1.2e-38 sig | 3o63-assembly1_A-2 Crystal Structure of Thiamin Phosphate Synthase from Mycobacterium tuberculosis |
3o63-assembly2_B-3 |
1.00 | 0.99 | 1.6e-36 sig | 3o63-assembly2_B-3 Crystal Structure of Thiamin Phosphate Synthase from Mycobacterium tuberculosis |
1xi3-assembly1_B |
1.00 | 0.90 | 3.6e-17 sig | 1xi3-assembly1_B Thiamine phosphate pyrophosphorylase from Pyrococcus furiosus Pfu-1255191-001 |
1g4t-assembly1_A |
1.00 | 0.87 | 5.2e-16 sig | 1g4t-assembly1_A THIAMIN PHOSPHATE SYNTHASE |
1g67-assembly1_A |
1.00 | 0.87 | 8.8e-16 sig | 1g67-assembly1_A THIAMIN PHOSPHATE SYNTHASE |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | mutT3 (+ strand, -17 bp gap) |
|---|---|
| Downstream (3' on genome) | thiO (+ strand, 129 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: thiD (hydroxymethylpyrimidine/phosphomethylpyrimidine kinase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0422c thiD exp |
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | 999 | 999 ctx | fusion:895 cooccurence:765 coexpression:742 database:900 textmining:595 |
Rv0417 thiG |
thiazole synthase | 994 | 990 ctx | neighborhood:774 cooccurence:735 coexpression:852 textmining:434 |
Rv0416 thiS |
sulfur carrier protein ThiS | 958 | 953 ctx | neighborhood:776 coexpression:798 |
Rv2977c thiL exp |
thiamine-monophosphate kinase | 944 | 908 | database:900 textmining:419 |
Rv3228 rsgA hyp exp |
hypothetical protein | 913 | 901 | database:900 |
Rv0423c thiC |
phosphomethylpyrimidine synthase | 902 | 873 | coexpression:809 |
Rv0415 thiO |
thiamine biosynthesis oxidoreductase ThiO | 888 | 873 ctx | neighborhood:776 cooccurence:412 |
Rv1173 fbiC |
FO synthase | 850 | 804 | coexpression:788 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 683 | 567 | coexpression:441 |
Rv1355c moeY |
molybdopterin biosynthesis protein MoeY | 576 | 542 | coexpression:441 |
Rv2338c moeW |
molybdopterin biosynthesis protein MoeW | 574 | 540 | coexpression:441 |
Rv3859c gltB |
glutamate synthase large subunit | 513 | 513 ctx | neighborhood:513 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 640 | 508 | coexpression:441 |
Rv2337c hyp |
hypothetical protein | 501 | 461 | coexpression:443 |
Rv0934 pstS1 |
phosphate ABC transporter substrate-binding lipoprotein PstS | 455 | 455 | coexpression:455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thiamine-phosphate synthase
- MTBC0 PGAP product: thiamine phosphate synthase
- Pfam (hmmscan --cut_ga): TMP-TENI PF02581.24 (E=2e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214928.1)
- Domains: Pfam-A via hmmscan --cut_ga — TMP-TENI (PF02581.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0352 - Curated reference: UniProt P9WG75 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
thiD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000434|Rv0414c|thiE MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for thiE? Email the maintainer — the message is pre-filled with this gene's details.