thiS Resolved · high auto-curated
H37Rv Rv0416 · MTBC0 mtbc0_000436 ·
68 aa · 505532–505738 (+) ·
RefSeq NP_214930.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sulfur carrier protein ThiS |
|---|---|
| MTBC0 PGAP re-annotation | sulfur carrier protein ThiS |
| Revised (this work) | Sulfur carrier protein ThiS. Pfam: ThiS (PF02597.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P96262
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible protein ThiS |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | thiS |
| eggNOG description | thiamine biosynthesis protein ThiS |
| Orthologous group | COG2104 |
| KEGG orthology |
K03154
|
| KEGG pathways |
map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.068 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ThiS | PF02597.27 | 5.5e-10 | 7–68 | ThiS family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: thiG (thiazole synthase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0417 thiG |
thiazole synthase | 999 | 999 ctx | neighborhood:882 coexpression:873 experimental:926 textmining:828 |
Rv0414c thiE |
thiamine-phosphate synthase | 958 | 953 ctx | neighborhood:776 coexpression:798 |
Rv0415 thiO |
thiamine biosynthesis oxidoreductase ThiO | 986 | 929 ctx | neighborhood:881 coexpression:430 textmining:817 |
Rv0423c thiC |
phosphomethylpyrimidine synthase | 851 | 842 | coexpression:804 |
Rv1334 mec |
[CysO | 848 | 827 | experimental:790 |
Rv3625c mesJ |
tRNA(Ile)-lysidine synthase | 821 | 813 | experimental:790 |
Rv0422c thiD |
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | 812 | 813 | coexpression:781 |
Rv1173 fbiC |
FO synthase | 771 | 761 | coexpression:741 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 774 | 749 | coexpression:490 experimental:463 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 773 | 748 | coexpression:488 experimental:463 |
Rv2743c hyp |
hypothetical protein | 711 | 712 ctx | cooccurence:709 |
Rv2338c moeW |
molybdopterin biosynthesis protein MoeW | 725 | 708 | coexpression:461 experimental:463 |
Rv2337c hyp |
hypothetical protein | 724 | 707 | coexpression:460 experimental:463 |
Rv1355c moeY |
molybdopterin biosynthesis protein MoeY | 724 | 707 | coexpression:459 experimental:463 |
Rv3196 hyp |
hypothetical protein | 715 | 698 | coexpression:450 experimental:455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sulfur carrier protein ThiS
- MTBC0 PGAP product: sulfur carrier protein ThiS
- Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=5e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214930.1)
- Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2104 - Curated reference: UniProt P96262 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
45 functional partner(s); context anchor
thiG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000436|Rv0416|thiS MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGG