thiS Resolved · high auto-curated

H37Rv Rv0416 · MTBC0 mtbc0_000436 · 68 aa · 505532–505738 (+) · RefSeq NP_214930.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sulfur carrier protein ThiS
MTBC0 PGAP re-annotationsulfur carrier protein ThiS
Revised (this work)Sulfur carrier protein ThiS. Pfam: ThiS (PF02597.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96262 TrEMBL · unreviewed · Predicted
UniProt namePossible protein ThiS

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namethiS
eggNOG descriptionthiamine biosynthesis protein ThiS
Orthologous groupCOG2104
KEGG orthology K03154
KEGG pathways map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.068 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThiSPF02597.27 5.5e-107–68 ThiS family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thiG (thiazole synthase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0417 thiG thiazole synthase 999 999 ctx neighborhood:882 coexpression:873 experimental:926 textmining:828
Rv0414c thiE thiamine-phosphate synthase 958 953 ctx neighborhood:776 coexpression:798
Rv0415 thiO thiamine biosynthesis oxidoreductase ThiO 986 929 ctx neighborhood:881 coexpression:430 textmining:817
Rv0423c thiC phosphomethylpyrimidine synthase 851 842 coexpression:804
Rv1334 mec [CysO 848 827 experimental:790
Rv3625c mesJ tRNA(Ile)-lysidine synthase 821 813 experimental:790
Rv0422c thiD hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 812 813 coexpression:781
Rv1173 fbiC FO synthase 771 761 coexpression:741
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 774 749 coexpression:490 experimental:463
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 773 748 coexpression:488 experimental:463
Rv2743c hyp hypothetical protein 711 712 ctx cooccurence:709
Rv2338c moeW molybdopterin biosynthesis protein MoeW 725 708 coexpression:461 experimental:463
Rv2337c hyp hypothetical protein 724 707 coexpression:460 experimental:463
Rv1355c moeY molybdopterin biosynthesis protein MoeY 724 707 coexpression:459 experimental:463
Rv3196 hyp hypothetical protein 715 698 coexpression:450 experimental:455

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sulfur carrier protein ThiS
  • MTBC0 PGAP product: sulfur carrier protein ThiS
  • Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=5e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214930.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2104
  • Curated reference: UniProt P96262 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor thiG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000436|Rv0416|thiS
MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLEVVTAVQGG