glnH Family assigned · medium auto-curated

H37Rv Rv0411c · MTBC0 mtbc0_000431 · 328 aa · 500679–501665 (-) · RefSeq NP_214925.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamine-binding lipoprotein GlnH
MTBC0 PGAP re-annotationglutamate ABC transporter substrate-binding protein
Revised (this work)Glutamate ABC transporter substrate-binding protein. Pfam: SBP_bac_3 (PF00497.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96257 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable glutamine-binding lipoprotein GlnH

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
T Signal transduction mechanisms
Preferred nameglnH
eggNOG descriptionABC transporter substrate-binding protein
Orthologous groupCOG0834
KEGG orthology K02030
KEGG modules M00236

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.425 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBP_bac_3PF00497.26 8.0e-2994–313 Bacterial extracellular solute-binding proteins, family 3

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: glnX (membrane protein), high confidence from genomic context alone (score 990 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0412c glnX membrane protein 994 990 ctx neighborhood:881 cooccurence:451 coexpression:860 textmining:489
Rv0410c pknG serine/threonine-protein kinase PknG 996 986 ctx neighborhood:882 coexpression:854 textmining:776
Rv0413 mutT3 8-oxo-dGTP diphosphatase 644 644 ctx neighborhood:635
Rv1658 argG argininosuccinate synthase 562 526 coexpression:415
Rv1659 argH argininosuccinate lyase 564 503
Rv2400c subI sulfate ABC transporter substrate-binding lipoprotein SubI 414 329
Rv1286 cysC adenylyl-sulfate kinase 450 279
Rv3759c proX glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX 408 171
Rv3859c gltB glutamate synthase large subunit 720 114 textmining:697
Rv0932c pstS2 phosphate ABC transporter substrate-binding lipoprotein PstS 450 97 textmining:416
Rv2116 lppK lipoprotein LppK 556 94 textmining:530
Rv1101c hyp hypothetical protein 554 71 textmining:540
Rv3623 lpqG lipoprotein LpqG 422 64 textmining:408
Rv1601 hisB imidazole glycerol-phosphate dehydratase 791 49 textmining:790
Rv1274 lprB lipoprotein LprB 471 46 textmining:468

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamine-binding lipoprotein GlnH
  • MTBC0 PGAP product: glutamate ABC transporter substrate-binding protein
  • Pfam (hmmscan --cut_ga): SBP_bac_3 PF00497.26 (E=8e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214925.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBP_bac_3 (PF00497.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0834
  • Curated reference: UniProt P96257 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor glnX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000431|Rv0411c|glnH
MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD