glnH Family assigned · medium auto-curated
H37Rv Rv0411c · MTBC0 mtbc0_000431 ·
328 aa · 500679–501665 (-) ·
RefSeq NP_214925.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glutamine-binding lipoprotein GlnH |
|---|---|
| MTBC0 PGAP re-annotation | glutamate ABC transporter substrate-binding protein |
| Revised (this work) | Glutamate ABC transporter substrate-binding protein. Pfam: SBP_bac_3 (PF00497.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P96257
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable glutamine-binding lipoprotein GlnH |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolismT Signal transduction mechanisms
|
|---|---|
| Preferred name | glnH |
| eggNOG description | ABC transporter substrate-binding protein |
| Orthologous group | COG0834 |
| KEGG orthology |
K02030
|
| KEGG modules |
M00236
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.425 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SBP_bac_3 | PF00497.26 | 8.0e-29 | 94–313 | Bacterial extracellular solute-binding proteins, family 3 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: glnX (membrane protein), high confidence from genomic context alone (score 990 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0412c glnX |
membrane protein | 994 | 990 ctx | neighborhood:881 cooccurence:451 coexpression:860 textmining:489 |
Rv0410c pknG |
serine/threonine-protein kinase PknG | 996 | 986 ctx | neighborhood:882 coexpression:854 textmining:776 |
Rv0413 mutT3 |
8-oxo-dGTP diphosphatase | 644 | 644 ctx | neighborhood:635 |
Rv1658 argG |
argininosuccinate synthase | 562 | 526 | coexpression:415 |
Rv1659 argH |
argininosuccinate lyase | 564 | 503 | |
Rv2400c subI |
sulfate ABC transporter substrate-binding lipoprotein SubI | 414 | 329 | |
Rv1286 cysC |
adenylyl-sulfate kinase | 450 | 279 | |
Rv3759c proX |
glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX | 408 | 171 | |
Rv3859c gltB |
glutamate synthase large subunit | 720 | 114 | textmining:697 |
Rv0932c pstS2 |
phosphate ABC transporter substrate-binding lipoprotein PstS | 450 | 97 | textmining:416 |
Rv2116 lppK |
lipoprotein LppK | 556 | 94 | textmining:530 |
Rv1101c hyp |
hypothetical protein | 554 | 71 | textmining:540 |
Rv3623 lpqG |
lipoprotein LpqG | 422 | 64 | textmining:408 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 791 | 49 | textmining:790 |
Rv1274 lprB |
lipoprotein LprB | 471 | 46 | textmining:468 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glutamine-binding lipoprotein GlnH
- MTBC0 PGAP product: glutamate ABC transporter substrate-binding protein
- Pfam (hmmscan --cut_ga): SBP_bac_3 PF00497.26 (E=8e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214925.1)
- Domains: Pfam-A via hmmscan --cut_ga — SBP_bac_3 (PF00497.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0834 - Curated reference: UniProt P96257 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
glnX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000431|Rv0411c|glnH MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD