Rv0390 Family assigned · medium auto-curated

H37Rv Rv0390 · MTBC0 mtbc0_000409 · 140 aa · 472955–473377 (+) · RefSeq NP_214904.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationrhodanese-like domain-containing protein
Revised (this work)Rhodanese-like domain-containing protein. Pfam: Rhodanese (PF00581.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95198 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionsulfurtransferase
Orthologous groupCOG0607

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.108 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RhodanesePF00581.26 2.8e-089–117 Rhodanese-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: metZ (O-succinylhomoserine sulfhydrylase), high confidence from genomic context alone (score 921 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0391 metZ O-succinylhomoserine sulfhydrylase 925 921 ctx neighborhood:882
Rv0389 purT phosphoribosylglycinamide formyltransferase PurT 882 882 ctx neighborhood:881
Rv3846 sodA superoxide dismutase 634 611 experimental:573
Rv2367c ybeY endoribonuclease 582 582 experimental:573
Rv3456c rplQ 50S ribosomal protein L17 516 516 experimental:466
Rv3443c rplM 50S ribosomal protein L13 510 510 experimental:453
Rv0710 rpsQ 30S ribosomal protein S17 506 506 experimental:476
Rv2442c rplU 50S ribosomal protein L21 500 501 experimental:466
Rv0640 rplK 50S ribosomal protein L11 491 492 experimental:461
Rv0701 rplC 50S ribosomal protein L3 491 491 experimental:450
Rv0715 rplX 50S ribosomal protein L24 485 486 experimental:453
Rv0723 rplO 50S ribosomal protein L15 481 482 experimental:453
Rv2643 arsC arsenic-transport integral membrane protein ArsC 465 441
Rv2582 ppiB peptidyl-prolyl cis-trans isomerase B 437 438 experimental:426
Rv0009 ppiA iron-regulated peptidyl-prolyl cis-trans isomerase PpiA 436 437 experimental:426

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: rhodanese-like domain-containing protein
  • Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214904.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0607
  • Curated reference: UniProt P95198 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor metZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000409|Rv0390|
MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLGREVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAGITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG