Rv0401 Still unknown · low auto-curated

H37Rv Rv0401 · MTBC0 mtbc0_000421 · 123 aa · 483153–483524 (+) · RefSeq NP_214915.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF3054 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3054. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95210 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3054)
Orthologous group2E6D0

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.413 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3054PF11255.14 4.2e-3110–112 Protein of unknown function (DUF3054)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE7 (acyl-CoA dehydrogenase FadE7), high confidence from genomic context alone (score 789 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0400c fadE7 acyl-CoA dehydrogenase FadE7 789 789 ctx neighborhood:789
Rv0399c lpqK lipoprotein LpqK 649 649 ctx neighborhood:649
Rv0398c hyp hypothetical protein 616 616 ctx neighborhood:616
Rv3399 S-adenosylmethionine-dependent methyltransferase 461 462 ctx neighborhood:462
Rv0360c hyp hypothetical protein 445 446 ctx cooccurence:444
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 440 440 ctx cooccurence:440
Rv0204c transmembrane protein 462 423 ctx neighborhood:418
Rv2740 ephG epoxide hydrolase 422 422 ctx cooccurence:422
Rv0921 resolvase 613 44 textmining:612
Rv2886c resolvase 586 44 textmining:585
Rv3828c resolvase 515 42 textmining:515
Rv2566 hyp hypothetical protein 870 41 textmining:870
Rv1272c drug ABC transporter ATP-binding protein 803 41 textmining:803
Rv3341 metA homoserine O-acetyltransferase 659 41 textmining:659
Rv0605 IS1536 family serine type transposase 616 41 textmining:616

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF3054 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3054 PF11255.14 (E=4e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214915.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3054 (PF11255.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E6D0
  • Curated reference: UniProt P95210 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor fadE7
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000421|Rv0401|
MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFLTGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAVLLLGWRAAVALMAPHRADG