Rv0395 Still unknown · low auto-curated

H37Rv Rv0395 · MTBC0 mtbc0_000414 · 134 aa · 478304–478708 (+) · RefSeq NP_214909.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 8csp-assembly1_5 Human mitochondrial small subunit assembly intermedia (prob 0.57, TM 0.50).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95203 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BWWP

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.65 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 63.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8csp-assembly1_5 0.57 0.50 2.1e-01 8csp-assembly1_5 Human mitochondrial small subunit assembly intermediate (State A)
5twb-assembly1_A 0.57 0.57 3.8e-01 5twb-assembly1_A Oxidoreductase IruO in the reduced form
5che-assembly1_B 0.51 0.43 1.5e-01 5che-assembly1_B Crystal structure of Arabidopsis glutamyl-tRNA reductase in complex with its regulatory proteins
9jxu-assembly1_A 0.44 0.42 1.5e-01 9jxu-assembly1_A Crystal structure of cysteine synthase A from Limosilactobacillus reuteri LR1 in its apo form
5jjc-assembly2_D 0.44 0.42 1.4e-01 5jjc-assembly2_D Crystal Structure of double mutant (Q96A-Y125A) O-Acetyl Serine Sulfhydralase from Brucella abortus
4gc5-assembly1_A 0.41 0.50 4.3e-01 4gc5-assembly1_A Crystal structure of murine TFB1M
6dnz-assembly1_D 0.28 0.38 3.1e-01 6dnz-assembly1_D Trypanosoma brucei PRMT1 enzyme-prozyme heterotetrameric complex with AdoHcy
4zem-assembly1_A 0.28 0.39 2.1e-01 4zem-assembly1_A Crystal structure of eIF2B beta from Chaetomium thermophilum

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0396 hyp hypothetical protein 889 889 ctx neighborhood:882
Rv0397 hyp hypothetical protein 619 619 ctx neighborhood:615
Rv0394c hyp hypothetical protein 598 599 ctx neighborhood:596
Rv3327 transposase fusion protein 503 93 textmining:475
Rv1371 membrane protein 668 87 textmining:652
Rv0894 transcriptional regulator 462 82 textmining:438
Rv3845 hyp hypothetical protein 871 55 textmining:870
Rv2283 hyp hypothetical protein 524 55 textmining:517
Rv3383c idsB polyprenyl synthetase IdsB 656 46 textmining:655
Rv1504c Rv1504c, (MTCY277.26c), len: 199 aa. Conserved hypothetical protein, similar to N-terminal region of P27833|RFFA_ECOLI lipopolysaccharide bi 810 45 textmining:810

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 8csp-assembly1_5 Human mitochondrial small subunit assembly intermediate (State (prob 0.57, E=2e-01, TM=0.50)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214909.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BWWP
  • Curated reference: UniProt P95203 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 63.7, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000414|Rv0395|
MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVLDEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPNVALLRLRDMAPSEHGSRCSSARGRLCLSMS